Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-RelB |
Location | 2355682..2356205 | Replicon | chromosome |
Accession | NZ_CP051514 | ||
Organism | Paraburkholderia aromaticivorans strain AR20-38 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | HF916_RS11055 | Protein ID | WP_206001821.1 |
Coordinates | 2355951..2356205 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | HF916_RS11050 | Protein ID | WP_168788829.1 |
Coordinates | 2355682..2355942 (+) | Length | 87 a.a. |
Genomic Context
Location: 2352670..2355192 (2523 bp)
Type: Others
Protein ID: WP_168788828.1
Type: Others
Protein ID: WP_168788828.1
Location: 2355682..2355942 (261 bp)
Type: Antitoxin
Protein ID: WP_168788829.1
Type: Antitoxin
Protein ID: WP_168788829.1
Location: 2355951..2356205 (255 bp)
Type: Toxin
Protein ID: WP_206001821.1
Type: Toxin
Protein ID: WP_206001821.1
Location: 2356265..2356537 (273 bp)
Type: Others
Protein ID: WP_168788831.1
Type: Others
Protein ID: WP_168788831.1
Location: 2356587..2356853 (267 bp)
Type: Others
Protein ID: WP_168788832.1
Type: Others
Protein ID: WP_168788832.1
Location: 2356946..2357098 (153 bp)
Type: Others
Protein ID: WP_168788833.1
Type: Others
Protein ID: WP_168788833.1
Location: 2357312..2357884 (573 bp)
Type: Others
Protein ID: WP_168788834.1
Type: Others
Protein ID: WP_168788834.1
Location: 2358325..2358912 (588 bp)
Type: Others
Protein ID: WP_168788836.1
Type: Others
Protein ID: WP_168788836.1
Location: 2358983..2359237 (255 bp)
Type: Others
Protein ID: WP_168788837.1
Type: Others
Protein ID: WP_168788837.1
Location: 2359596..2359895 (300 bp)
Type: Others
Protein ID: WP_168788838.1
Type: Others
Protein ID: WP_168788838.1
Location: 2351084..2351680 (597 bp)
Type: Others
Protein ID: WP_168788826.1
Type: Others
Protein ID: WP_168788826.1
Location: 2351661..2352047 (387 bp)
Type: Others
Protein ID: WP_168788827.1
Type: Others
Protein ID: WP_168788827.1
Location: 2357943..2358257 (315 bp)
Type: Others
Protein ID: WP_168788835.1
Type: Others
Protein ID: WP_168788835.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HF916_RS11035 | 2351084..2351680 | - | 597 | WP_168788826.1 | DUF1173 family protein | - |
HF916_RS11040 | 2351661..2352047 | - | 387 | WP_168788827.1 | DUF1173 family protein | - |
HF916_RS11045 | 2352670..2355192 | + | 2523 | WP_168788828.1 | adenosylcobalamin-dependent ribonucleoside-diphosphate reductase | - |
HF916_RS11050 | 2355682..2355942 | + | 261 | WP_168788829.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
HF916_RS11055 | 2355951..2356205 | + | 255 | WP_206001821.1 | Txe/YoeB family addiction module toxin | Toxin |
HF916_RS11060 | 2356265..2356537 | + | 273 | WP_168788831.1 | hypothetical protein | - |
HF916_RS11065 | 2356587..2356853 | + | 267 | WP_168788832.1 | hypothetical protein | - |
HF916_RS11070 | 2356946..2357098 | + | 153 | WP_168788833.1 | hypothetical protein | - |
HF916_RS11075 | 2357312..2357884 | + | 573 | WP_168788834.1 | hypothetical protein | - |
HF916_RS11080 | 2357943..2358257 | - | 315 | WP_168788835.1 | hypothetical protein | - |
HF916_RS11085 | 2358325..2358912 | + | 588 | WP_168788836.1 | hypothetical protein | - |
HF916_RS11090 | 2358983..2359237 | + | 255 | WP_168788837.1 | hypothetical protein | - |
HF916_RS11095 | 2359596..2359895 | + | 300 | WP_168788838.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9983.34 Da Isoelectric Point: 8.8663
>T154364 WP_206001821.1 NZ_CP051514:2355951-2356205 [Paraburkholderia aromaticivorans]
MNILWTAEAWDDYVYWQGPDKKTLKRINQLVKDMQRSPFDGVGKPESLKQNLTGFWSRRIDETNRLVYEVAGTQINIVSC
RYHY
MNILWTAEAWDDYVYWQGPDKKTLKRINQLVKDMQRSPFDGVGKPESLKQNLTGFWSRRIDETNRLVYEVAGTQINIVSC
RYHY
Download Length: 255 bp
>T154364 NZ_CP068033:1867613-1867715 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 87 a.a. Molecular weight: 9676.07 Da Isoelectric Point: 7.3198
>AT154364 WP_168788829.1 NZ_CP051514:2355682-2355942 [Paraburkholderia aromaticivorans]
MRTIPFSDARANLKRVIDQVVDDVDVTLITRRDAPNAILMSQEHYDSLMETVHLLRSPANVAHLERSIAQARAGKVKPRK
LAEDAE
MRTIPFSDARANLKRVIDQVVDDVDVTLITRRDAPNAILMSQEHYDSLMETVHLLRSPANVAHLERSIAQARAGKVKPRK
LAEDAE
Download Length: 261 bp
>AT154364 NZ_CP068033:c1867722-1867577 [Klebsiella pneumoniae]
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT