Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 623979..624505 | Replicon | chromosome |
Accession | NZ_CP051430 | ||
Organism | Escherichia sp. SCLE84 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | HGD79_RS03290 | Protein ID | WP_000323025.1 |
Coordinates | 624218..624505 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | HGD79_RS03285 | Protein ID | WP_000534858.1 |
Coordinates | 623979..624218 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HGD79_RS03260 | 619313..619669 | + | 357 | WP_001374839.1 | class I SAM-dependent methyltransferase | - |
HGD79_RS26340 | 620280..620567 | + | 288 | Protein_642 | hypothetical protein | - |
HGD79_RS03270 | 621336..622677 | + | 1342 | Protein_643 | ISNCY family transposase | - |
HGD79_RS03275 | 623114..623446 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
HGD79_RS03280 | 623649..623954 | - | 306 | WP_168848292.1 | hypothetical protein | - |
HGD79_RS03285 | 623979..624218 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
HGD79_RS03290 | 624218..624505 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
HGD79_RS03295 | 624577..624732 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
HGD79_RS03300 | 624949..625200 | + | 252 | WP_000980994.1 | hypothetical protein | - |
HGD79_RS03305 | 625267..625545 | + | 279 | WP_012304870.1 | hypothetical protein | - |
HGD79_RS03310 | 625547..626596 | + | 1050 | WP_168848293.1 | DUF968 domain-containing protein | - |
HGD79_RS03315 | 626610..627362 | + | 753 | WP_001047135.1 | antitermination protein | - |
HGD79_RS03320 | 627640..627729 | - | 90 | WP_120795389.1 | hypothetical protein | - |
HGD79_RS03325 | 627784..627996 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
HGD79_RS03330 | 628297..628512 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
HGD79_RS03335 | 629266..629481 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 599082..659733 | 60651 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T154101 WP_000323025.1 NZ_CP051430:624218-624505 [Escherichia sp. SCLE84]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T154101 NZ_CP067342:212811-212918 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT154101 WP_000534858.1 NZ_CP051430:623979-624218 [Escherichia sp. SCLE84]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT154101 NZ_CP067342:c212763-212697 [Escherichia coli]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|