Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3241250..3241776 | Replicon | chromosome |
Accession | NZ_CP051001 | ||
Organism | Escherichia coli O157:H16 str. 98-3133 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | BY40_RS15880 | Protein ID | WP_000323025.1 |
Coordinates | 3241250..3241537 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | BY40_RS15885 | Protein ID | WP_000534858.1 |
Coordinates | 3241537..3241776 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BY40_RS15830 (3236274) | 3236274..3236489 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
BY40_RS15835 (3236709) | 3236709..3236879 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
BY40_RS15840 (3237243) | 3237243..3237458 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
BY40_RS15845 (3237759) | 3237759..3237971 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
BY40_RS15850 (3238026) | 3238026..3238115 | + | 90 | WP_120795389.1 | hypothetical protein | - |
BY40_RS15855 (3238393) | 3238393..3239145 | - | 753 | WP_001047135.1 | antitermination protein | - |
BY40_RS15860 (3239159) | 3239159..3240208 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
BY40_RS15865 (3240210) | 3240210..3240488 | - | 279 | WP_012304870.1 | hypothetical protein | - |
BY40_RS15870 (3240555) | 3240555..3240806 | - | 252 | WP_000980994.1 | protein Rem | - |
BY40_RS15875 (3241023) | 3241023..3241178 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
BY40_RS15880 (3241250) | 3241250..3241537 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
BY40_RS15885 (3241537) | 3241537..3241776 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
BY40_RS15890 (3241801) | 3241801..3242106 | + | 306 | WP_001326990.1 | protein YdfV | - |
BY40_RS15895 (3242309) | 3242309..3242641 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
BY40_RS24230 (3243078) | 3243078..3243227 | - | 150 | WP_011443592.1 | protein YdfW | - |
BY40_RS15900 (3243348) | 3243348..3244370 | - | 1023 | Protein_3116 | ISNCY family transposase | - |
BY40_RS15905 (3245160) | 3245160..3245447 | - | 288 | Protein_3117 | hypothetical protein | - |
BY40_RS15910 (3245925) | 3245925..3246414 | - | 490 | Protein_3118 | class I SAM-dependent methyltransferase | - |
BY40_RS15915 (3246411) | 3246411..3246662 | - | 252 | Protein_3119 | DUF977 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3211086..3269647 | 58561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T153514 WP_000323025.1 NZ_CP051001:c3241537-3241250 [Escherichia coli O157:H16 str. 98-3133]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T153514 NZ_CP066937:c4627283-4627149 [Xanthomonas campestris pv. campestris]
ATGAAGCGTGCAATTGCATTGTTGGTGCTGTCGATGTTGTCGGTTGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCCGCGCGCAAGTGA
ATGAAGCGTGCAATTGCATTGTTGGTGCTGTCGATGTTGTCGGTTGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCCGCGCGCAAGTGA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT153514 WP_000534858.1 NZ_CP051001:c3241776-3241537 [Escherichia coli O157:H16 str. 98-3133]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT153514 NZ_CP066937:c4627512-4627360 [Xanthomonas campestris pv. campestris]
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTCTCGGCCGGCATGATGACTGGCTGTAACACCATGGCTGGTGC
CGGAAAGGACATGCAGGGTGCGGGTGACAAGGTCGAGAAGACCGCCGACAAATGCAGCGACGGTAAGTGCTAA
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTCTCGGCCGGCATGATGACTGGCTGTAACACCATGGCTGGTGC
CGGAAAGGACATGCAGGGTGCGGGTGACAAGGTCGAGAAGACCGCCGACAAATGCAGCGACGGTAAGTGCTAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|