Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 696509..696956 | Replicon | plasmid unnamed |
Accession | NZ_CP050953 | ||
Organism | Rhodococcus sp. DMU1 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | HFP48_RS31160 | Protein ID | WP_168581187.1 |
Coordinates | 696509..696730 (+) | Length | 74 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | HFP48_RS31165 | Protein ID | WP_168581112.1 |
Coordinates | 696720..696956 (+) | Length | 79 a.a. |
Genomic Context
Location: 693706..694950 (1245 bp)
Type: Others
Protein ID: Protein_621
Type: Others
Protein ID: Protein_621
Location: 695274..695417 (144 bp)
Type: Others
Protein ID: WP_168581109.1
Type: Others
Protein ID: WP_168581109.1
Location: 696509..696730 (222 bp)
Type: Toxin
Protein ID: WP_168581187.1
Type: Toxin
Protein ID: WP_168581187.1
Location: 696720..696956 (237 bp)
Type: Antitoxin
Protein ID: WP_168581112.1
Type: Antitoxin
Protein ID: WP_168581112.1
Location: 697054..697342 (289 bp)
Type: Others
Protein ID: Protein_627
Type: Others
Protein ID: Protein_627
Location: 701036..701302 (267 bp)
Type: Others
Protein ID: WP_168581189.1
Type: Others
Protein ID: WP_168581189.1
Location: 695449..695799 (351 bp)
Type: Others
Protein ID: WP_168581110.1
Type: Others
Protein ID: WP_168581110.1
Location: 695802..696260 (459 bp)
Type: Others
Protein ID: WP_168581111.1
Type: Others
Protein ID: WP_168581111.1
Location: 697737..699146 (1410 bp)
Type: Others
Protein ID: WP_168581188.1
Type: Others
Protein ID: WP_168581188.1
Location: 699191..699372 (182 bp)
Type: Others
Protein ID: Protein_629
Type: Others
Protein ID: Protein_629
Location: 699819..700124 (306 bp)
Type: Others
Protein ID: WP_168580683.1
Type: Others
Protein ID: WP_168580683.1
Location: 700138..700842 (705 bp)
Type: Others
Protein ID: WP_168581113.1
Type: Others
Protein ID: WP_168581113.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HFP48_RS31140 | 693706..694950 | + | 1245 | Protein_621 | AAA family ATPase | - |
HFP48_RS31145 | 695274..695417 | + | 144 | WP_168581109.1 | hypothetical protein | - |
HFP48_RS31150 | 695449..695799 | - | 351 | WP_168581110.1 | hypothetical protein | - |
HFP48_RS31155 | 695802..696260 | - | 459 | WP_168581111.1 | prevent-host-death protein | - |
HFP48_RS31160 | 696509..696730 | + | 222 | WP_168581187.1 | BrnT family toxin | Toxin |
HFP48_RS31165 | 696720..696956 | + | 237 | WP_168581112.1 | CopG family transcriptional regulator | Antitoxin |
HFP48_RS31170 | 697054..697342 | + | 289 | Protein_627 | hypothetical protein | - |
HFP48_RS31175 | 697737..699146 | - | 1410 | WP_168581188.1 | plasmid pRiA4b ORF-3 family protein | - |
HFP48_RS31180 | 699191..699372 | - | 182 | Protein_629 | hypothetical protein | - |
HFP48_RS31185 | 699819..700124 | - | 306 | WP_168580683.1 | alpha/beta hydrolase | - |
HFP48_RS31190 | 700138..700842 | - | 705 | WP_168581113.1 | DUF899 family protein | - |
HFP48_RS31195 | 701036..701302 | + | 267 | WP_168581189.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..716018 | 716018 | |
- | flank | IS/Tn | - | - | 701387..702340 | 953 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 74 a.a. Molecular weight: 8375.57 Da Isoelectric Point: 10.2993
>T153469 WP_168581187.1 NZ_CP050953:696509-696730 [Rhodococcus sp. DMU1]
MAKHGIDFLSAQALWRDPHRLEVPAKTTDEPRWLVIGVIDGKWWSAVVTYRAGRTRIISVRRSRDGEVAPYES
MAKHGIDFLSAQALWRDPHRLEVPAKTTDEPRWLVIGVIDGKWWSAVVTYRAGRTRIISVRRSRDGEVAPYES
Download Length: 222 bp
>T153469 NZ_CP066916:53208-53357 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 79 a.a. Molecular weight: 9011.04 Da Isoelectric Point: 4.6702
>AT153469 WP_168581112.1 NZ_CP050953:696720-696956 [Rhodococcus sp. DMU1]
MRADEFDERFDAGEDVTFALDTARARRPGEEQRRVNVDFPAWMIAELDREATRLGVTRQSLIKVWIAERLERNGSTAT
MRADEFDERFDAGEDVTFALDTARARRPGEEQRRVNVDFPAWMIAELDREATRLGVTRQSLIKVWIAERLERNGSTAT
Download Length: 237 bp
>AT153469 NZ_CP066916:c53163-53104 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT