Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta(toxin)
Location 1160..41311 Replicon plasmid p1
Accession NZ_CP050931
Organism Neisseria gonorrhoeae strain NG211

Toxin (Protein)


Gene name ng_zeta1 Uniprot ID -
Locus tag GHB95_RS11655 Protein ID WP_033911112.1
Coordinates 41311..1160 (+) Length -13383.333333333 a.a.

Antitoxin (Protein)


Gene name ng_epsilon1 Uniprot ID D5K9G8
Locus tag GHB95_RS11660 Protein ID WP_003701903.1
Coordinates 1175..1606 (+) Length 144 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GHB95_RS11660 (GHB95_11595) 1175..1606 + 432 WP_003701903.1 hypothetical protein Antitoxin
GHB95_RS11665 (GHB95_11600) 1658..2212 + 555 WP_003701901.1 recombinase family protein -
GHB95_RS11670 (GHB95_11605) 2322..2612 - 291 WP_003701899.1 virulence factor -
GHB95_RS11675 (GHB95_11610) 2715..3314 - 600 WP_003701898.1 TrbN protein -
GHB95_RS11680 (GHB95_11615) 3314..3886 - 573 WP_226888038.1 TrbM/KikA/MpfK family conjugal transfer protein -
GHB95_RS11685 (GHB95_11620) 3879..5486 - 1608 WP_226888039.1 P-type conjugative transfer protein TrbL -
GHB95_RS11690 (GHB95_11625) 5721..6497 - 777 WP_003701891.1 P-type conjugative transfer protein TrbJ -
GHB95_RS11695 (GHB95_11630) 6510..7949 - 1440 WP_033910174.1 TrbI/VirB10 family protein -
GHB95_RS11700 (GHB95_11635) 7953..8363 - 411 WP_003701887.1 TrbH protein -
GHB95_RS11705 (GHB95_11640) 8360..9226 - 867 WP_003701885.1 P-type conjugative transfer protein TrbG -
GHB95_RS11710 (GHB95_11645) 9239..9946 - 708 WP_033910171.1 VirB8/TrbF family protein -
GHB95_RS11715 (GHB95_11650) 9946..12510 - 2565 WP_003701881.1 VirB4 family type IV secretion/conjugal transfer ATPase -
GHB95_RS11720 (GHB95_11655) 12507..12824 - 318 WP_013085581.1 conjugal transfer protein TrbD -
GHB95_RS11725 (GHB95_11660) 12829..13212 - 384 WP_003701877.1 conjugal transfer system pilin TrbC -
GHB95_RS11730 (GHB95_11665) 13314..14312 - 999 WP_003701874.1 P-type conjugative transfer ATPase TrbB -
GHB95_RS11735 (GHB95_11670) 14440..14805 - 366 WP_003701872.1 transcriptional regulator -
GHB95_RS11740 (GHB95_11675) 14865..15248 + 384 WP_003701870.1 single-stranded DNA-binding protein -
GHB95_RS11745 (GHB95_11680) 15252..16130 + 879 WP_003701868.1 plasmid replication initiator TrfA -
GHB95_RS11750 (GHB95_11685) 16748..17095 + 348 WP_003701866.1 hypothetical protein -
GHB95_RS11755 (GHB95_11690) 17176..17421 + 246 WP_003701863.1 hypothetical protein -
GHB95_RS11760 (GHB95_11695) 17431..18186 + 756 WP_003701861.1 ParA family protein -
GHB95_RS11765 (GHB95_11700) 18192..19109 + 918 WP_003701858.1 ParB/RepB/Spo0J family partition protein -
GHB95_RS11770 (GHB95_11705) 19316..19672 + 357 WP_003701856.1 hypothetical protein -
GHB95_RS11775 (GHB95_11710) 19709..20245 + 537 WP_003701854.1 hypothetical protein -
GHB95_RS11780 (GHB95_11715) 20302..20784 - 483 WP_003701852.1 hypothetical protein -
GHB95_RS11785 (GHB95_11720) 20792..21517 - 726 WP_164823309.1 conjugal transfer protein TraL -
GHB95_RS11790 21518..22219 - 702 WP_226888040.1 TraK family protein -
GHB95_RS11795 (GHB95_11730) 22269..22646 + 378 WP_003701845.1 conjugal transfer protein TraJ -
GHB95_RS11800 (GHB95_11735) 22649..25042 + 2394 WP_033910166.1 relaxase/mobilization nuclease domain-containing protein -
GHB95_RS11805 (GHB95_11740) 25059..26948 + 1890 WP_003701841.1 type IV secretory system conjugative DNA transfer family protein -
GHB95_RS11810 (GHB95_11745) 26945..27481 + 537 WP_003701840.1 conjugative transfer signal peptidase TraF -
GHB95_RS11815 (GHB95_11750) 27484..29679 + 2196 WP_013085583.1 DNA topoisomerase 3 -
GHB95_RS11820 (GHB95_11755) 29701..29865 + 165 WP_003701838.1 hypothetical protein -
GHB95_RS11825 (GHB95_11760) 29868..32867 + 3000 WP_014580052.1 DUF5710 domain-containing protein -
GHB95_RS11830 (GHB95_11765) 32900..33370 + 471 WP_228547154.1 transcription elongation factor -
GHB95_RS11835 33367..33419 + 53 Protein_36 twin-arginine translocation signal domain-containing protein -
GHB95_RS11840 (GHB95_11770) 33493..33927 + 435 WP_229505493.1 DUF882 domain-containing protein -
GHB95_RS11845 (GHB95_11775) 33924..34283 + 360 WP_003701922.1 hypothetical protein -
GHB95_RS11850 (GHB95_11780) 34650..34964 + 315 WP_082295984.1 hypothetical protein -
GHB95_RS11855 (GHB95_11785) 34978..35319 + 342 WP_013085576.1 hypothetical protein -
GHB95_RS11860 (GHB95_11790) 35323..36219 + 897 WP_003701917.1 hypothetical protein -
GHB95_RS11865 (GHB95_11795) 36371..36844 - 474 WP_013085577.1 hypothetical protein -
GHB95_RS11870 (GHB95_11800) 36936..38855 - 1920 WP_025456273.1 tetracycline resistance ribosomal protection protein Tet(M) -
GHB95_RS11875 (GHB95_11805) 38871..38987 - 117 WP_001791010.1 tetracycline resistance determinant leader peptide -
GHB95_RS11880 (GHB95_11810) 39632..39880 + 249 WP_014580056.1 hypothetical protein -
GHB95_RS11885 (GHB95_11815) 39877..41085 + 1209 WP_014580057.1 zeta toxin family protein -
GHB95_RS11890 (GHB95_11820) 41119..41304 + 186 WP_014580058.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(M) - 1..41356 41356


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(6-129)

Antitoxin

(7-47)


Sequences


Toxin        


Download         Length: -13383.333333333 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T153457 WP_033911112.1 NZ_CP050931:41311-1160 [Neisseria gonorrhoeae]

Download         Length: -40150 bp

>T153457 NZ_CP066915:399679-400122 [Klebsiella pneumoniae]
ATGAAGAAAACCTGGATGCTCGACACTAACATCTGCTCGTTCATCATGCGCGAGCAGCCGGCAGCGGTGCTGAAGCGCCT
GGAACAGGCGGTGCTGCGCGGTGATCGCATCGTGGTCTCGGCCGTGACGTATGCCGAGATGCGCTTCGGCGCCACCGGCC
CGAAGGCCTCGCCGCGCCATATTCAGCTGGTCGACGCGTTCTGCGCGCGCCTCGATGCCATCCTGCCCTGGGACCGGGCC
GCGGTGGACGCCACGACGGACATCCGGGTGGCGCTGCGCCTCGCCGGGACGCCGATCGGCCCGAACGACACGGCCATTGC
TGGGCACGCTATCGCGGCCGGCGCCGTCCTAGTGACGAACAATGTGAGAGAGTTTGAGCGGGTGCCGGGTCTGGTGCTGG
AAGACTGGGTGAAGAAAGCCGCTCTCTGCAGGGTAATTTCTTGA

Antitoxin


Download         Length: 144 a.a.        Molecular weight: 15927.05 Da        Isoelectric Point: 4.4211

>AT153457 WP_003701903.1 NZ_CP050931:1175-1606 [Neisseria gonorrhoeae]
MKEKMRLITEISLIIRELSYSRRGYRPESYAAALDNLTIIGDLADILHNIEAATGNPFVQRMVDEKLRKFVTDFPAYKVR
LSPFLNGCPHDLSLGAESLGKGESIADALAVPPEEVDIADIEFDRVLIEDDRWTGAYDGGNAQ

Download         Length: 432 bp

>AT153457 NZ_CP066915:399452-399682 [Klebsiella pneumoniae]
ATGCGCACAGTTTCGATATTTAAAAACGGCAATAACCGCGCCATCCGTCTGCCCCGGGACCTGGATTTTGACGGCGTCAG
CGAGCTGGAGATCGTCCGGGAAGGGGACAGCATCATTCTGCGTCCCGTCCGGCCGACCTGGGGCTCGTTCGCGCAGCTGG
ACAGGGCCGCTCCGGACTTTATGGCGGAGCGTGAGGATGTGGTCAGCGATGAAGGACGCTTTGAGCCATGA

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Source ID Structure
AlphaFold DB D5K9G8

References