Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2238308..2238834 | Replicon | chromosome |
Accession | NZ_CP049112 | ||
Organism | Escherichia coli strain WF5-5-T2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | G6R06_RS10890 | Protein ID | WP_000323025.1 |
Coordinates | 2238547..2238834 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | G6R06_RS10885 | Protein ID | WP_000534858.1 |
Coordinates | 2238308..2238547 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6R06_RS10825 (2233336) | 2233336..2234103 | - | 768 | Protein_2113 | exonuclease | - |
G6R06_RS10830 (2234196) | 2234196..2234387 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
G6R06_RS10835 (2234384) | 2234384..2234572 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
G6R06_RS10840 (2235140) | 2235140..2235358 | - | 219 | WP_001171942.1 | protein YdfC | - |
G6R06_RS10845 (2235388) | 2235388..2235516 | - | 129 | WP_000344964.1 | protein YdfB | - |
G6R06_RS10850 (2235518) | 2235518..2235673 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
G6R06_RS10855 (2235840) | 2235840..2236247 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
G6R06_RS10860 (2236331) | 2236331..2236561 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
G6R06_RS10865 (2236545) | 2236545..2236823 | + | 279 | Protein_2121 | protein YdfX | - |
G6R06_RS10870 (2236858) | 2236858..2237007 | + | 150 | WP_011443592.1 | protein YdfW | - |
G6R06_RS10875 (2237443) | 2237443..2237775 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
G6R06_RS10880 (2237978) | 2237978..2238283 | - | 306 | WP_001326990.1 | protein YdfV | - |
G6R06_RS10885 (2238308) | 2238308..2238547 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
G6R06_RS10890 (2238547) | 2238547..2238834 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
G6R06_RS10895 (2238906) | 2238906..2239061 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
G6R06_RS10900 (2239278) | 2239278..2239529 | + | 252 | WP_000980994.1 | protein Rem | - |
G6R06_RS10905 (2239596) | 2239596..2239874 | + | 279 | WP_012304870.1 | hypothetical protein | - |
G6R06_RS10910 (2239876) | 2239876..2240925 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
G6R06_RS10915 (2240939) | 2240939..2241691 | + | 753 | WP_001047135.1 | antitermination protein | - |
G6R06_RS10920 (2241969) | 2241969..2242058 | - | 90 | WP_120795389.1 | hypothetical protein | - |
G6R06_RS10925 (2242113) | 2242113..2242325 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
G6R06_RS10930 (2242626) | 2242626..2242841 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
G6R06_RS10935 (2243205) | 2243205..2243375 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
G6R06_RS10940 (2243595) | 2243595..2243810 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2227437..2270152 | 42715 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T150568 WP_000323025.1 NZ_CP049112:2238547-2238834 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T150568 NZ_CP064819:c65912-65736 [Bacillus subtilis]
GTGCTTGAGAAAGTGGGTATTATAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGATAAGAAATCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACATATACGCCGATGA
GTGCTTGAGAAAGTGGGTATTATAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGATAAGAAATCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACATATACGCCGATGA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT150568 WP_000534858.1 NZ_CP049112:2238308-2238547 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT150568 NZ_CP064819:65853-65953 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATAATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATAATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|