Detailed information of TA system TA148553

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RelE-HTH
• Location: 262308..262699
• Replicon: chromosome
• Accession: NZ_CP047939
• Organism: Synechococcus sp. BMK-MC-1

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: SynBMKMC1_RS01285
• Protein ID: WP_186472442.1
• Coordinates: 262592..262699 (+)
• Length: 36 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: SynBMKMC1_RS01280
• Protein ID: WP_186472441.1
• Coordinates: 262308..262529 (+)
• Length: 74 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
SynBMKMC1_RS01240	257464..258081	+	618	WP_186472437.1	Uma2 family endonuclease	-
SynBMKMC1_RS01245	258171..259355	+	1185	Protein_244	GDP-mannose 4,6-dehydratase	-
SynBMKMC1_RS01250	259382..259630	+	249	WP_186473268.1	type II toxin-antitoxin system prevent-host-death family antitoxin	-
SynBMKMC1_RS01255	259630..259964	+	335	Protein_246	type II toxin-antitoxin system VapC family toxin	-
SynBMKMC1_RS01260	260047..260943	+	897	Protein_247	GDP-L-fucose synthase	-
SynBMKMC1_RS01265	261000..261227	+	228	WP_186472438.1	type II toxin-antitoxin system prevent-host-death family antitoxin	-
SynBMKMC1_RS01270	261217..261657	+	441	WP_186472439.1	type II toxin-antitoxin system VapC family toxin	-
SynBMKMC1_RS01275	261858..262271	+	414	WP_186472440.1	hypothetical protein	-
SynBMKMC1_RS01280	262308..262529	+	222	WP_186472441.1	ribbon-helix-helix protein, CopG family	Antitoxin
SynBMKMC1_RS01285	262592..262699	+	108	WP_186472442.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
SynBMKMC1_RS01290	262992..263222	+	231	WP_185190568.1	hypothetical protein	-
SynBMKMC1_RS01295	263227..263685	+	459	WP_186472443.1	type II toxin-antitoxin system VapC family toxin	-
SynBMKMC1_RS01300	263678..263857	+	180	WP_186472444.1	hypothetical protein	-
SynBMKMC1_RS01305	264087..265247	+	1161	WP_186472445.1	GDP-mannose 4,6-dehydratase	-
SynBMKMC1_RS01310	265244..266215	+	972	WP_186472446.1	GDP-L-fucose synthase	-
SynBMKMC1_RS01315	266273..266500	+	228	WP_186473269.1	type II toxin-antitoxin system HicB family antitoxin	-
SynBMKMC1_RS01320	266497..266673	+	177	WP_186472447.1	type II toxin-antitoxin system HicA family toxin	-
SynBMKMC1_RS01325	266681..266800	+	120	Protein_260	SDR family NAD-dependent epimerase/dehydratase	-
SynBMKMC1_RS01330	266807..267040	+	234	WP_186473270.1	type II toxin-antitoxin system prevent-host-death family antitoxin	-
SynBMKMC1_RS01335	267272..267607	-	336	WP_186472448.1	nucleotidyltransferase domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	gmd / gmd	258171..275333	17162

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (2-34)

Antitoxin

• Ribbon-helix-helix protein, CopG (4-40)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4340.11 Da
• Isoelectric Point: 11.6909

>T148553 WP_186472442.1 NZ_CP047939:262592-262699 [Synechococcus sp. BMK-MC-1]
VRPLRVGSYRVVYEWQRSELVILVVRIGHRREVYR

Nucleotide

• Length: 108 bp

>T148553 NZ_CP063774:c2491665-2491558 [Escherichia coli O25b:H4-ST131]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA

Antitoxin

Protein

• Length: 74 a.a.
• Molecular weight: 8077.09 Da
• Isoelectric Point: 3.8895

>AT148553 WP_186472441.1 NZ_CP047939:262308-262529 [Synechococcus sp. BMK-MC-1]
MVQVTARLPDELGAELDAAAAQLSRCRADIIRQAIEFYLDDIEDLRFGVAALKDPADPVLDWSEVRDAFLATD

Nucleotide

• Length: 222 bp

>AT148553 NZ_CP063774:2491722-2491779 [Escherichia coli O25b:H4-ST131]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT