Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1462321..1462941 | Replicon | chromosome |
Accession | NZ_CP047553 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF10231 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | DXN27_RS06995 | Protein ID | WP_001280991.1 |
Coordinates | 1462321..1462539 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | DXN27_RS07000 | Protein ID | WP_000344807.1 |
Coordinates | 1462567..1462941 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXN27_RS06955 (1457869) | 1457869..1458114 | + | 246 | Protein_1344 | YbaY family lipoprotein | - |
DXN27_RS06960 (1458147) | 1458147..1458536 | - | 390 | WP_000961285.1 | MGMT family protein | - |
DXN27_RS06970 (1458767) | 1458767..1460317 | - | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
DXN27_RS06975 (1460542) | 1460542..1460802 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
DXN27_RS06980 (1460808) | 1460808..1460948 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
DXN27_RS06985 (1461004) | 1461004..1461474 | - | 471 | WP_000136181.1 | YlaC family protein | - |
DXN27_RS06990 (1461591) | 1461591..1462142 | - | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
DXN27_RS06995 (1462321) | 1462321..1462539 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
DXN27_RS07000 (1462567) | 1462567..1462941 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
DXN27_RS07005 (1463437) | 1463437..1466586 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
DXN27_RS07010 (1466609) | 1466609..1467802 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T146670 WP_001280991.1 NZ_CP047553:c1462539-1462321 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
>T146670 NZ_CP062771:3148543-3148650 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT146670 WP_000344807.1 NZ_CP047553:c1462941-1462567 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
>AT146670 NZ_CP062771:c3148495-3148436 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|