Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3536494..3537114 | Replicon | chromosome |
Accession | NZ_CP047525 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF11077 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | DXN14_RS17515 | Protein ID | WP_001280991.1 |
Coordinates | 3536896..3537114 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | DXN14_RS17510 | Protein ID | WP_000344807.1 |
Coordinates | 3536494..3536868 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXN14_RS17500 | 3531633..3532826 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
DXN14_RS17505 | 3532849..3535998 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
DXN14_RS17510 | 3536494..3536868 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
DXN14_RS17515 | 3536896..3537114 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
DXN14_RS17520 | 3537293..3537844 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
DXN14_RS17525 | 3537961..3538431 | + | 471 | WP_000136181.1 | YlaC family protein | - |
DXN14_RS17530 | 3538487..3538627 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
DXN14_RS17535 | 3538633..3538893 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
DXN14_RS17540 | 3539118..3540668 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
DXN14_RS17550 | 3540899..3541288 | + | 390 | WP_000961285.1 | MGMT family protein | - |
DXN14_RS17555 | 3541321..3541890 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T146372 WP_001280991.1 NZ_CP047525:3536896-3537114 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
>T146372 NZ_CP062744:c2601729-2601622 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT146372 WP_000344807.1 NZ_CP047525:3536494-3536868 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
>AT146372 NZ_CP062744:2601782-2601843 [Escherichia coli O157:H7]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|