Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 361024..361562 | Replicon | chromosome |
Accession | NZ_CP047306 | ||
Organism | Vibrio cholerae O37 strain ATCC 25872 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q9KMJ0 |
Locus tag | GTH07_RS15090 | Protein ID | WP_000802136.1 |
Coordinates | 361024..361323 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | GTH07_RS15095 | Protein ID | WP_001107719.1 |
Coordinates | 361320..361562 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTH07_RS15055 (GTH07_15105) | 356531..356890 | + | 360 | WP_001071529.1 | VOC family protein | - |
GTH07_RS15060 (GTH07_15110) | 357037..357690 | + | 654 | WP_000895163.1 | hypothetical protein | - |
GTH07_RS15070 (GTH07_15120) | 358239..358922 | + | 684 | WP_000877436.1 | hypothetical protein | - |
GTH07_RS15075 (GTH07_15125) | 359136..359402 | + | 267 | WP_000937852.1 | hypothetical protein | - |
GTH07_RS15080 (GTH07_15130) | 360108..360287 | + | 180 | WP_001883058.1 | DUF645 family protein | - |
GTH07_RS15085 (GTH07_15135) | 360501..360896 | + | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
GTH07_RS15090 (GTH07_15140) | 361024..361323 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GTH07_RS15095 (GTH07_15145) | 361320..361562 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
GTH07_RS15100 (GTH07_15150) | 361791..362369 | + | 579 | WP_000110120.1 | hypothetical protein | - |
GTH07_RS15105 (GTH07_15155) | 362391..362483 | + | 93 | WP_014164112.1 | DUF3265 domain-containing protein | - |
GTH07_RS18640 | 362757..362879 | + | 123 | WP_228840823.1 | DUF3709 domain-containing protein | - |
GTH07_RS15115 (GTH07_15165) | 363158..363436 | + | 279 | WP_001012254.1 | hypothetical protein | - |
GTH07_RS18645 (GTH07_15170) | 363495..363620 | + | 126 | WP_088126107.1 | DUF3265 domain-containing protein | - |
GTH07_RS15120 (GTH07_15175) | 363701..364162 | + | 462 | Protein_360 | lipocalin family protein | - |
GTH07_RS18650 | 364227..364307 | + | 81 | Protein_361 | acetyltransferase | - |
GTH07_RS15125 (GTH07_15180) | 364310..364606 | + | 297 | WP_000617998.1 | Dabb family protein | - |
GTH07_RS15130 (GTH07_15190) | 365745..366371 | + | 627 | WP_001889198.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 307620..433724 | 126104 | |
- | inside | Integron | - | - | 312700..433348 | 120648 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T145907 WP_000802136.1 NZ_CP047306:c361323-361024 [Vibrio cholerae O37]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T145907 NZ_CP062708:3115103-3115210 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT145907 WP_001107719.1 NZ_CP047306:c361562-361320 [Vibrio cholerae O37]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT145907 NZ_CP062708:c3115050-3114989 [Escherichia coli O157:H7]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|