Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 346558..347117 Replicon chromosome
Accession NZ_CP047306
Organism Vibrio cholerae O37 strain ATCC 25872

Toxin (Protein)


Gene name relE Uniprot ID Q9K2M8
Locus tag GTH07_RS14970 Protein ID WP_000578476.1
Coordinates 346558..346836 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag GTH07_RS14975 Protein ID WP_000381183.1
Coordinates 346833..347117 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GTH07_RS14925 (GTH07_14965) 341636..342142 + 507 WP_000393074.1 hypothetical protein -
GTH07_RS14930 (GTH07_14970) 342299..342685 + 387 WP_000703163.1 VOC family protein -
GTH07_RS14935 (GTH07_14975) 342942..343145 + 204 WP_001911580.1 hypothetical protein -
GTH07_RS14940 (GTH07_14980) 343340..343591 + 252 WP_001890111.1 TIGR03643 family protein -
GTH07_RS14945 (GTH07_14985) 343564..343713 + 150 WP_071908333.1 DUF3265 domain-containing protein -
GTH07_RS14950 (GTH07_14990) 343860..344285 + 426 WP_000415750.1 hypothetical protein -
GTH07_RS14955 (GTH07_14995) 344491..345114 + 624 WP_000247070.1 DUF1349 domain-containing protein -
GTH07_RS14960 (GTH07_15000) 345327..345806 + 480 WP_000009888.1 lecithin retinol acyltransferase family protein -
GTH07_RS18625 (GTH07_15005) 345803..345919 + 117 WP_086010882.1 DUF3265 domain-containing protein -
GTH07_RS14965 (GTH07_15010) 345994..346407 + 414 WP_000049420.1 VOC family protein -
GTH07_RS14970 (GTH07_15020) 346558..346836 - 279 WP_000578476.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
GTH07_RS14975 (GTH07_15025) 346833..347117 - 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
GTH07_RS14980 (GTH07_15030) 347366..347827 + 462 WP_001911578.1 lipocalin family protein -
GTH07_RS14985 (GTH07_15035) 347892..348488 + 597 WP_000255434.1 hypothetical protein -
GTH07_RS18630 348682..348819 + 138 WP_001890145.1 hypothetical protein -
GTH07_RS14990 (GTH07_15040) 348880..349062 + 183 WP_000923182.1 DUF645 family protein -
GTH07_RS14995 (GTH07_15045) 349262..349735 + 474 WP_001161076.1 GrpB family protein -
GTH07_RS15000 (GTH07_15050) 349750..349842 + 93 WP_014378730.1 DUF3265 domain-containing protein -
GTH07_RS15005 (GTH07_15055) 349852..350550 + 699 WP_001890502.1 hypothetical protein -
GTH07_RS15010 (GTH07_15060) 350581..350670 + 90 WP_072606010.1 DUF3265 domain-containing protein -
GTH07_RS15015 (GTH07_15065) 350699..351634 + 936 WP_000051985.1 restriction endonuclease -
GTH07_RS15020 (GTH07_15070) 351600..351740 + 141 WP_001883049.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 307620..433724 126104
- inside Integron - - 312700..433348 120648


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10819.59 Da        Isoelectric Point: 5.1651

>T145906 WP_000578476.1 NZ_CP047306:c346836-346558 [Vibrio cholerae O37]
MIFWEEASLNDREKIFEFLYDFNPAAAKKTDELIEAKVENLLEQPLIGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

>T145906 NZ_CP062708:3114567-3114674 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT145906 WP_000381183.1 NZ_CP047306:c347117-346833 [Vibrio cholerae O37]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp

>AT145906 NZ_CP062708:c3114519-3114460 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9K2M8

Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References