Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicA |
Location | 3955675..3956087 | Replicon | chromosome |
Accession | NZ_CP046973 | ||
Organism | Microcystis aeruginosa FD4 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | GQR42_RS19755 | Protein ID | WP_199273353.1 |
Coordinates | 3955675..3955878 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L7E1N4 |
Locus tag | GQR42_RS19760 | Protein ID | WP_002739801.1 |
Coordinates | 3955878..3956087 (+) | Length | 70 a.a. |
Genomic Context
Location: 3951033..3951605 (573 bp)
Type: Others
Protein ID: WP_158201275.1
Type: Others
Protein ID: WP_158201275.1
Location: 3953945..3954457 (513 bp)
Type: Others
Protein ID: WP_158201280.1
Type: Others
Protein ID: WP_158201280.1
Location: 3954478..3955587 (1110 bp)
Type: Others
Protein ID: WP_158201281.1
Type: Others
Protein ID: WP_158201281.1
Location: 3955675..3955878 (204 bp)
Type: Toxin
Protein ID: WP_199273353.1
Type: Toxin
Protein ID: WP_199273353.1
Location: 3955878..3956087 (210 bp)
Type: Antitoxin
Protein ID: WP_002739801.1
Type: Antitoxin
Protein ID: WP_002739801.1
Location: 3956098..3956208 (111 bp)
Type: Others
Protein ID: Protein_3931
Type: Others
Protein ID: Protein_3931
Location: 3956214..3956435 (222 bp)
Type: Others
Protein ID: WP_158201282.1
Type: Others
Protein ID: WP_158201282.1
Location: 3956717..3956974 (258 bp)
Type: Others
Protein ID: WP_158201283.1
Type: Others
Protein ID: WP_158201283.1
Location: 3956990..3958579 (1590 bp)
Type: Others
Protein ID: WP_158201284.1
Type: Others
Protein ID: WP_158201284.1
Location: 3951594..3952322 (729 bp)
Type: Others
Protein ID: WP_158201276.1
Type: Others
Protein ID: WP_158201276.1
Location: 3952322..3952684 (363 bp)
Type: Others
Protein ID: WP_158201277.1
Type: Others
Protein ID: WP_158201277.1
Location: 3952681..3952998 (318 bp)
Type: Others
Protein ID: WP_158201278.1
Type: Others
Protein ID: WP_158201278.1
Location: 3953306..3953923 (618 bp)
Type: Others
Protein ID: WP_158201279.1
Type: Others
Protein ID: WP_158201279.1
Location: 3958553..3959800 (1248 bp)
Type: Others
Protein ID: WP_158201285.1
Type: Others
Protein ID: WP_158201285.1
Location: 3960187..3960912 (726 bp)
Type: Others
Protein ID: WP_158201286.1
Type: Others
Protein ID: WP_158201286.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GQR42_RS19720 | 3951033..3951605 | + | 573 | WP_158201275.1 | manganese efflux pump MntP family protein | - |
GQR42_RS19725 | 3951594..3952322 | - | 729 | WP_158201276.1 | 7-cyano-7-deazaguanine synthase QueC | - |
GQR42_RS19730 | 3952322..3952684 | - | 363 | WP_158201277.1 | aspartyl protease | - |
GQR42_RS19735 | 3952681..3952998 | - | 318 | WP_158201278.1 | hypothetical protein | - |
GQR42_RS19740 | 3953306..3953923 | - | 618 | WP_158201279.1 | 7-carboxy-7-deazaguanine synthase QueE | - |
GQR42_RS19745 | 3953945..3954457 | + | 513 | WP_158201280.1 | Ycf51 family protein | - |
GQR42_RS19750 | 3954478..3955587 | + | 1110 | WP_158201281.1 | iron-containing alcohol dehydrogenase family protein | - |
GQR42_RS19755 | 3955675..3955878 | + | 204 | WP_199273353.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
GQR42_RS19760 | 3955878..3956087 | + | 210 | WP_002739801.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
GQR42_RS19765 | 3956098..3956208 | + | 111 | Protein_3931 | type II toxin-antitoxin system HigB family toxin | - |
GQR42_RS19770 | 3956214..3956435 | + | 222 | WP_158201282.1 | hypothetical protein | - |
GQR42_RS19775 | 3956717..3956974 | + | 258 | WP_158201283.1 | hypothetical protein | - |
GQR42_RS19780 | 3956990..3958579 | + | 1590 | WP_158201284.1 | DUF3352 domain-containing protein | - |
GQR42_RS19785 | 3958553..3959800 | - | 1248 | WP_158201285.1 | bifunctional folylpolyglutamate synthase/dihydrofolate synthase | - |
GQR42_RS19790 | 3960187..3960912 | - | 726 | WP_158201286.1 | 2-phosphosulfolactate phosphatase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 7577.78 Da Isoelectric Point: 10.7591
>T145250 WP_199273353.1 NZ_CP046973:3955675-3955878 [Microcystis aeruginosa FD4]
MVKKVKQVIKVLEADGWYLARTRGSHRQYKHPSKSGTVTVSGKSSVDVPIGTLKNIWRQAQIEEDKI
MVKKVKQVIKVLEADGWYLARTRGSHRQYKHPSKSGTVTVSGKSSVDVPIGTLKNIWRQAQIEEDKI
Download Length: 204 bp
>T145250 NZ_CP062344:19314-19490 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 70 a.a. Molecular weight: 7499.58 Da Isoelectric Point: 3.8950
>AT145250 WP_002739801.1 NZ_CP046973:3955878-3956087 [Microcystis aeruginosa FD4]
MRYAVVIEKGENSYGAYVPDLPGCVAVAETLEEVKQLIAEAIIFHLEGLKEDGLTVPESLSICEYVDVA
MRYAVVIEKGENSYGAYVPDLPGCVAVAETLEEVKQLIAEAIIFHLEGLKEDGLTVPESLSICEYVDVA
Download Length: 210 bp
>AT145250 NZ_CP062344:c19652-19478 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | L7E1N4 |