Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 950620..951160 | Replicon | chromosome |
Accession | NZ_CP046849 | ||
Organism | Vibrio cincinnatiensis strain F8054 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | GPX94_RS17165 | Protein ID | WP_158147745.1 |
Coordinates | 950620..950889 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1T4SKS5 |
Locus tag | GPX94_RS17170 | Protein ID | WP_032480862.1 |
Coordinates | 950882..951160 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPX94_RS17115 | 945698..946660 | - | 963 | WP_078925954.1 | integron integrase | - |
GPX94_RS17120 | 947462..947743 | + | 282 | WP_000086650.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GPX94_RS17125 | 947740..948027 | + | 288 | WP_154116254.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GPX94_RS17130 | 948037..948147 | + | 111 | WP_154116889.1 | DUF3265 domain-containing protein | - |
GPX94_RS17135 | 948137..948388 | + | 252 | WP_199251712.1 | acetyltransferase | - |
GPX94_RS17140 | 948388..948789 | + | 402 | WP_000351249.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
GPX94_RS17145 | 948951..949376 | + | 426 | WP_158147742.1 | N-acetyltransferase | - |
GPX94_RS17150 | 949405..949494 | + | 90 | WP_158147743.1 | hypothetical protein | - |
GPX94_RS17155 | 949523..949981 | + | 459 | WP_158147744.1 | hypothetical protein | - |
GPX94_RS17160 | 950482..950592 | + | 111 | WP_129533207.1 | DUF3265 domain-containing protein | - |
GPX94_RS17165 | 950620..950889 | - | 270 | WP_158147745.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
GPX94_RS17170 | 950882..951160 | - | 279 | WP_032480862.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
GPX94_RS17175 | 951217..951327 | + | 111 | WP_158137443.1 | DUF3265 domain-containing protein | - |
GPX94_RS17180 | 951411..952124 | + | 714 | WP_176429172.1 | Fic family protein | - |
GPX94_RS17185 | 952121..952231 | + | 111 | Protein_861 | DUF3265 domain-containing protein | - |
GPX94_RS17195 | 952812..952922 | + | 111 | WP_158145475.1 | DUF3265 domain-containing protein | - |
GPX94_RS17200 | 952961..953530 | + | 570 | WP_158147746.1 | flavodoxin family protein | - |
GPX94_RS17205 | 954960..955517 | + | 558 | WP_158145089.1 | hypothetical protein | - |
GPX94_RS17210 | 955524..955634 | + | 111 | WP_158145473.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | cqsA / katB | 1..1034285 | 1034284 | |
- | inside | Integron | - | - | 945698..969207 | 23509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10236.89 Da Isoelectric Point: 8.9357
>T145107 WP_158147745.1 NZ_CP046849:c950889-950620 [Vibrio cincinnatiensis]
MYSLEYSSQFKKDFKKITKMPISDIIEVGNIISKLQRGEKLDPKNVDHPLTGGWVGFRDCHVKPDLVLIYRIFDGQLQLA
RIGSHSDLF
MYSLEYSSQFKKDFKKITKMPISDIIEVGNIISKLQRGEKLDPKNVDHPLTGGWVGFRDCHVKPDLVLIYRIFDGQLQLA
RIGSHSDLF
Download Length: 270 bp
>T145107 NZ_CP062312:c181048-180953 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 93 a.a. Molecular weight: 10053.51 Da Isoelectric Point: 6.0643
>AT145107 WP_032480862.1 NZ_CP046849:c951160-950882 [Vibrio cincinnatiensis]
MRTEMLSTRIDHDTKVAFTSICDEMGLSTSQAIKIFAKAVINHGGIPFDLRVPQPNETTISAMNELVQGHGHKAESVDAM
LTELTEGKVKNV
MRTEMLSTRIDHDTKVAFTSICDEMGLSTSQAIKIFAKAVINHGGIPFDLRVPQPNETTISAMNELVQGHGHKAESVDAM
LTELTEGKVKNV
Download Length: 279 bp
>AT145107 NZ_CP062312:180868-180925 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|