Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 89..1770944 | Replicon | chromosome |
| Accession | NZ_CP046833 | ||
| Organism | Vibrio vulnificus strain 06-2410 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A4Q7HXF9 |
| Locus tag | GPY16_RS15045 | Protein ID | WP_045627860.1 |
| Coordinates | 89..367 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | GPY16_RS15040 | Protein ID | WP_045627858.1 |
| Coordinates | 1770944..92 (+) | Length | -590283.66666667 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPY16_RS15045 | 89..367 | + | 279 | WP_045627860.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| GPY16_RS15050 | 398..508 | - | 111 | Protein_2 | DUF3265 domain-containing protein | - |
| GPY16_RS15055 | 505..930 | - | 426 | WP_017420108.1 | hypothetical protein | - |
| GPY16_RS15060 | 1615..2130 | - | 516 | WP_045594920.1 | lipocalin family protein | - |
| GPY16_RS15065 | 2261..3340 | - | 1080 | WP_045627862.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| GPY16_RS15070 | 3524..4252 | - | 729 | WP_158105595.1 | MipA/OmpV family protein | - |
| GPY16_RS15075 | 4467..5597 | - | 1131 | WP_158105596.1 | VarG family subclass B1-like metallo-beta-lactamase | - |
| GPY16_RS15080 | 5712..6644 | + | 933 | WP_158105597.1 | LysR family transcriptional regulator | - |
| GPY16_RS15085 | 6758..7558 | - | 801 | WP_158105598.1 | hypothetical protein | - |
| GPY16_RS15090 | 7545..9071 | - | 1527 | WP_158105599.1 | FAD-dependent oxidoreductase | - |
| GPY16_RS15095 | 9305..9727 | - | 423 | WP_039538622.1 | hypothetical protein | - |
| GPY16_RS15100 | 10153..10740 | + | 588 | WP_045594914.1 | response regulator transcription factor | - |
| GPY16_RS15105 | 10838..12193 | - | 1356 | WP_158105600.1 | GGDEF domain-containing protein | - |
| GPY16_RS15110 | 12227..12826 | - | 600 | WP_039538614.1 | response regulator transcription factor | - |
| GPY16_RS15115 | 12828..13988 | - | 1161 | WP_039538612.1 | EAL domain-containing response regulator | - |
| GPY16_RS15120 | 13981..17634 | - | 3654 | WP_158105601.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS15125 | 17995..18357 | - | 363 | WP_026050781.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
| GPY16_RS15130 | 18660..32627 | + | 13968 | WP_158105602.1 | type I secretion C-terminal target domain-containing protein | - |
| GPY16_RS15135 | 32639..34792 | + | 2154 | WP_158105603.1 | type I secretion system permease/ATPase | - |
| GPY16_RS15140 | 34789..36117 | + | 1329 | WP_158105604.1 | HlyD family type I secretion periplasmic adaptor subunit | - |
| GPY16_RS15145 | 36135..37445 | + | 1311 | WP_038939974.1 | TolC family outer membrane protein | - |
| GPY16_RS15150 | 37447..38061 | + | 615 | WP_158105605.1 | OmpA family protein | - |
| GPY16_RS15155 | 38089..38997 | + | 909 | WP_158105606.1 | substrate-binding domain-containing protein | - |
| GPY16_RS15160 | 39231..39953 | + | 723 | WP_165386196.1 | carbonic anhydrase | - |
| GPY16_RS15165 | 40079..41182 | - | 1104 | WP_039449089.1 | mechanosensitive ion channel family protein | - |
| GPY16_RS15170 | 41442..41789 | + | 348 | WP_011082374.1 | hypothetical protein | - |
| GPY16_RS15175 | 41998..43626 | + | 1629 | WP_017422362.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS15180 | 43698..44444 | - | 747 | WP_017422363.1 | flagellar brake protein | - |
| GPY16_RS15185 | 44623..44898 | + | 276 | WP_038939982.1 | N-acetyltransferase | - |
| GPY16_RS15190 | 44953..45453 | - | 501 | WP_017422365.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS15195 | 45742..49008 | + | 3267 | WP_158105607.1 | PD40 domain-containing protein | - |
| GPY16_RS15200 | 49160..50341 | + | 1182 | WP_015727563.1 | MFS transporter | - |
| GPY16_RS15205 | 50399..51241 | - | 843 | WP_158105608.1 | energy-coupling factor transporter transmembrane protein EcfT | - |
| GPY16_RS15210 | 51238..52962 | - | 1725 | WP_039538574.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS15215 | 52969..53517 | - | 549 | WP_011082383.1 | ECF-type riboflavin transporter substrate-binding protein | - |
| GPY16_RS15220 | 53751..54881 | - | 1131 | WP_038939988.1 | HlyD family secretion protein | - |
| GPY16_RS15225 | 54881..55264 | - | 384 | WP_015727568.1 | DUF3302 domain-containing protein | - |
| GPY16_RS15230 | 55471..57054 | - | 1584 | WP_015727569.1 | GGDEF domain-containing protein | - |
| GPY16_RS15235 | 57035..58534 | - | 1500 | WP_017422372.1 | hypothetical protein | - |
| GPY16_RS15240 | 58695..60163 | - | 1469 | Protein_40 | IS1 family transposase | - |
| GPY16_RS15245 | 60215..60925 | - | 711 | WP_039545529.1 | purine-nucleoside phosphorylase | - |
| GPY16_RS15250 | 61341..62294 | + | 954 | WP_039538568.1 | DUF1722 domain-containing protein | - |
| GPY16_RS15255 | 62284..63090 | + | 807 | WP_045609686.1 | MerR family transcriptional regulator | - |
| GPY16_RS15260 | 63099..64508 | + | 1410 | WP_193774079.1 | deoxyribodipyrimidine photo-lyase | - |
| GPY16_RS15265 | 64509..65426 | + | 918 | WP_080527097.1 | L,D-transpeptidase family protein | - |
| GPY16_RS15270 | 65447..65725 | - | 279 | WP_011082394.1 | membrane protein | - |
| GPY16_RS15275 | 66082..67425 | + | 1344 | WP_038939993.1 | DEAD/DEAH box helicase | - |
| GPY16_RS15280 | 67654..69708 | + | 2055 | WP_158105609.1 | prolyl oligopeptidase family serine peptidase | - |
| GPY16_RS15285 | 69709..71844 | + | 2136 | WP_158105610.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| GPY16_RS15290 | 71861..74152 | + | 2292 | WP_158105611.1 | proprotein convertase P-domain-containing protein | - |
| GPY16_RS15295 | 74168..75619 | + | 1452 | WP_158105612.1 | DUF1566 domain-containing protein | - |
| GPY16_RS15300 | 75621..76181 | + | 561 | WP_026050774.1 | DUF1566 domain-containing protein | - |
| GPY16_RS15305 | 76292..78181 | - | 1890 | WP_158105613.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS15310 | 78493..80136 | - | 1644 | WP_158105614.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS15315 | 80606..81427 | + | 822 | WP_039538541.1 | phosphate ABC transporter substrate-binding protein | - |
| GPY16_RS15320 | 81516..82448 | + | 933 | WP_026050773.1 | phosphate ABC transporter permease subunit PstC | - |
| GPY16_RS15325 | 82470..83333 | + | 864 | WP_038940001.1 | phosphate ABC transporter permease PstA | - |
| GPY16_RS15330 | 83383..84141 | + | 759 | WP_072599201.1 | phosphate ABC transporter ATP-binding protein | - |
| GPY16_RS15335 | 84408..86509 | + | 2102 | Protein_59 | GGDEF domain-containing protein | - |
| GPY16_RS15340 | 86595..88226 | - | 1632 | WP_158105615.1 | BatD family protein | - |
| GPY16_RS15345 | 88237..90057 | - | 1821 | WP_199245045.1 | VWA domain-containing protein | - |
| GPY16_RS15350 | 90050..91021 | - | 972 | WP_158105617.1 | VWA domain-containing protein | - |
| GPY16_RS15355 | 91014..91484 | - | 471 | WP_039538526.1 | DUF4381 domain-containing protein | - |
| GPY16_RS15360 | 91490..92407 | - | 918 | WP_080533634.1 | DUF58 domain-containing protein | - |
| GPY16_RS15365 | 92411..93367 | - | 957 | WP_158105618.1 | MoxR family ATPase | - |
| GPY16_RS15370 | 93667..95580 | + | 1914 | WP_158105619.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS15375 | 95628..95828 | + | 201 | WP_158105620.1 | restriction endonuclease subunit S | - |
| GPY16_RS15380 | 96004..96669 | + | 666 | WP_026050768.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS15385 | 96864..97523 | + | 660 | WP_017422393.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS15390 | 97811..98383 | + | 573 | WP_158105621.1 | biofilm matrix calcium-binding repeat protein CabA | - |
| GPY16_RS15395 | 98428..100140 | + | 1713 | WP_039538520.1 | type I secretion system permease/ATPase | - |
| GPY16_RS15400 | 100133..101473 | + | 1341 | WP_158105622.1 | HlyD family type I secretion periplasmic adaptor subunit | - |
| GPY16_RS15405 | 101659..101982 | - | 324 | WP_011082421.1 | VanZ family protein | - |
| GPY16_RS15410 | 102056..103369 | - | 1314 | WP_052152914.1 | oligosaccharide flippase family protein | - |
| GPY16_RS15415 | 103380..104411 | - | 1032 | WP_017422398.1 | glycosyltransferase | - |
| GPY16_RS15420 | 104408..105241 | - | 834 | WP_130359717.1 | putative capsular polysaccharide synthesis family protein | - |
| GPY16_RS15425 | 105459..106499 | - | 1041 | WP_158105623.1 | glycosyltransferase | - |
| GPY16_RS15430 | 106523..108703 | - | 2181 | WP_026050764.1 | polysaccharide biosynthesis tyrosine autokinase | - |
| GPY16_RS15435 | 108723..109256 | - | 534 | WP_017422402.1 | polysaccharide export protein | - |
| GPY16_RS15440 | 109270..110484 | - | 1215 | WP_158105624.1 | outer membrane beta-barrel protein | - |
| GPY16_RS15445 | 110519..111919 | - | 1401 | WP_017422404.1 | undecaprenyl-phosphate glucose phosphotransferase | - |
| GPY16_RS15450 | 112334..113449 | - | 1116 | WP_011082430.1 | maltose/maltodextrin ABC transporter ATP-binding protein MalK | - |
| GPY16_RS15455 | 114119..115300 | + | 1182 | WP_017422406.1 | maltose/maltodextrin ABC transporter substrate-binding protein MalE | - |
| GPY16_RS15460 | 115375..116946 | + | 1572 | WP_038940019.1 | maltose ABC transporter permease MalF | - |
| GPY16_RS15465 | 116965..117855 | + | 891 | WP_017422408.1 | maltose ABC transporter permease MalG | - |
| GPY16_RS15470 | 118222..118467 | - | 246 | WP_011082434.1 | hypothetical protein | - |
| GPY16_RS15475 | 118608..119093 | - | 486 | WP_011082435.1 | acyl-CoA thioesterase | - |
| GPY16_RS15480 | 119207..120115 | - | 909 | WP_158105625.1 | DMT family transporter | - |
| GPY16_RS15485 | 120215..121003 | + | 789 | WP_026050763.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS15490 | 120998..121915 | - | 918 | WP_158105626.1 | M14 family metallocarboxypeptidase | - |
| GPY16_RS15495 | 122088..123002 | + | 915 | WP_158105627.1 | DUF808 domain-containing protein | - |
| GPY16_RS15500 | 122999..124162 | - | 1164 | WP_017791611.1 | GGDEF domain-containing protein | - |
| GPY16_RS15505 | 124293..125321 | - | 1029 | WP_158105628.1 | dihydroorotase | - |
| GPY16_RS15510 | 125591..127411 | + | 1821 | WP_158105629.1 | hybrid-cluster NAD(P)-dependent oxidoreductase | - |
| GPY16_RS15515 | 127524..128354 | - | 831 | WP_038968997.1 | ammonia-dependent NAD(+) synthetase | - |
| GPY16_RS15520 | 128503..129027 | + | 525 | WP_017422418.1 | nicotinate-nicotinamide nucleotide adenylyltransferase | - |
| GPY16_RS15525 | 129048..129527 | + | 480 | WP_039450196.1 | hypothetical protein | - |
| GPY16_RS15530 | 129645..130250 | - | 606 | WP_039450160.1 | hypothetical protein | - |
| GPY16_RS15535 | 130455..131558 | + | 1104 | WP_158105630.1 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
| GPY16_RS15540 | 131647..132258 | - | 612 | WP_080932727.1 | hypothetical protein | - |
| GPY16_RS15545 | 132338..132643 | + | 306 | WP_039545480.1 | YnjH family protein | - |
| GPY16_RS15550 | 132669..132968 | - | 300 | WP_017422424.1 | YfcZ/YiiS family protein | - |
| GPY16_RS15555 | 133497..133958 | + | 462 | WP_011082451.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS15560 | 134047..134832 | - | 786 | WP_046028619.1 | heme ABC transporter ATP-binding protein | - |
| GPY16_RS15565 | 134829..135860 | - | 1032 | WP_158105631.1 | iron ABC transporter permease | - |
| GPY16_RS15570 | 135870..136721 | - | 852 | WP_158105632.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS15575 | 136733..137146 | - | 414 | WP_158105633.1 | biopolymer transporter ExbD | - |
| GPY16_RS15580 | 137139..137831 | - | 693 | WP_038968283.1 | MotA/TolQ/ExbB proton channel family protein | - |
| GPY16_RS15585 | 137834..138556 | - | 723 | WP_158105634.1 | energy transducer TonB | - |
| GPY16_RS15590 | 138717..140090 | + | 1374 | WP_045627920.1 | heme anaerobic degradation radical SAM methyltransferase ChuW/HutW | - |
| GPY16_RS15595 | 140162..140665 | + | 504 | WP_011082459.1 | heme utilization cystosolic carrier protein HutX | - |
| GPY16_RS15600 | 140704..141234 | + | 531 | WP_011082460.1 | heme utilization protein HutZ | - |
| GPY16_RS15605 | 141339..141872 | + | 534 | WP_011082461.1 | ATP:cob(I)alamin adenosyltransferase | - |
| GPY16_RS15610 | 141893..142816 | - | 924 | WP_017422434.1 | chemotaxis protein | - |
| GPY16_RS15615 | 142984..143262 | + | 279 | WP_011082463.1 | peptidylprolyl isomerase | - |
| GPY16_RS15620 | 143499..143924 | + | 426 | WP_158105635.1 | universal stress protein | - |
| GPY16_RS15625 | 144362..145741 | + | 1380 | WP_158105636.1 | alpha-amylase family protein | - |
| GPY16_RS15630 | 145836..147704 | - | 1869 | WP_039545461.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS15635 | 147846..149717 | - | 1872 | WP_017422439.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS15640 | 150423..151451 | + | 1029 | WP_039469872.1 | acyltransferase | - |
| GPY16_RS15645 | 151448..152671 | + | 1224 | WP_158105637.1 | O-antigen ligase family protein | - |
| GPY16_RS15650 | 152786..154162 | - | 1377 | WP_038940039.1 | YjiH family protein | - |
| GPY16_RS15655 | 154458..155126 | - | 669 | WP_011082471.1 | DUF1275 domain-containing protein | - |
| GPY16_RS15660 | 155277..155666 | - | 390 | WP_072599713.1 | GFA family protein | - |
| GPY16_RS15665 | 155753..156379 | + | 627 | WP_158105638.1 | hypothetical protein | - |
| GPY16_RS15670 | 156484..157773 | + | 1290 | WP_039545458.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| GPY16_RS15675 | 157868..158515 | - | 648 | WP_039545456.1 | HAD family phosphatase | - |
| GPY16_RS15680 | 158626..159525 | - | 900 | WP_158105639.1 | fused MFS/spermidine synthase | - |
| GPY16_RS15685 | 159515..160150 | - | 636 | WP_097353460.1 | fused MFS/spermidine synthase | - |
| GPY16_RS15690 | 160348..161223 | + | 876 | WP_017791638.1 | NAD(P)-dependent oxidoreductase | - |
| GPY16_RS15695 | 161288..161482 | - | 195 | WP_158106074.1 | hypothetical protein | - |
| GPY16_RS15700 | 161494..162051 | - | 558 | WP_158105640.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS15705 | 162114..162722 | - | 609 | WP_026131050.1 | DUF2913 family protein | - |
| GPY16_RS15715 | 163392..164600 | + | 1209 | WP_015727633.1 | NupC/NupG family nucleoside CNT transporter | - |
| GPY16_RS15720 | 164710..165807 | - | 1098 | WP_038964697.1 | DUF3541 domain-containing protein | - |
| GPY16_RS15725 | 165878..166489 | - | 612 | WP_158105641.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| GPY16_RS15730 | 166632..168011 | + | 1380 | WP_045627927.1 | sensor domain-containing diguanylate cyclase | - |
| GPY16_RS15735 | 168134..170128 | - | 1995 | WP_158105642.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS15740 | 170568..172091 | - | 1524 | WP_017422455.1 | DUF3612 domain-containing protein | - |
| GPY16_RS15745 | 172274..172846 | + | 573 | WP_015727639.1 | malate synthase | - |
| GPY16_RS15750 | 173006..174022 | - | 1017 | WP_026131051.1 | GGDEF domain-containing protein | - |
| GPY16_RS15755 | 174430..175572 | - | 1143 | WP_158105643.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| GPY16_RS15760 | 175720..176118 | + | 399 | WP_158105644.1 | OsmC family protein | - |
| GPY16_RS15765 | 176242..176790 | + | 549 | WP_011082492.1 | sugar O-acetyltransferase | - |
| GPY16_RS15770 | 176848..177534 | - | 687 | WP_039545442.1 | YafY family transcriptional regulator | - |
| GPY16_RS15775 | 177579..177893 | - | 315 | WP_038964482.1 | hypothetical protein | - |
| GPY16_RS15780 | 177946..178869 | - | 924 | WP_038940049.1 | LysR family transcriptional regulator | - |
| GPY16_RS15785 | 178995..179669 | + | 675 | WP_158105645.1 | pyrimidine 5'-nucleotidase | - |
| GPY16_RS15790 | 179672..180598 | - | 927 | WP_017422463.1 | AraC family transcriptional regulator | - |
| GPY16_RS15795 | 180712..180984 | + | 273 | WP_011151841.1 | nitrate/nitrite transporter NrtS | - |
| GPY16_RS15800 | 180989..181891 | + | 903 | WP_039466794.1 | chemotaxis protein | - |
| GPY16_RS15805 | 181927..182634 | - | 708 | WP_199245046.1 | lipoate--protein ligase | - |
| GPY16_RS15810 | 182708..183862 | - | 1155 | WP_026050743.1 | PLP-dependent aminotransferase family protein | - |
| GPY16_RS15815 | 183976..184845 | + | 870 | WP_026050742.1 | AraC family transcriptional regulator | - |
| GPY16_RS15820 | 184919..185734 | - | 816 | WP_158105647.1 | phosphonoacetaldehyde hydrolase | - |
| GPY16_RS15825 | 185824..187203 | - | 1380 | WP_158105648.1 | aspartate aminotransferase family protein | - |
| GPY16_RS15830 | 187230..188333 | - | 1104 | WP_005374069.1 | 2-aminoethylphosphonate--pyruvate transaminase | - |
| GPY16_RS15835 | 188601..189611 | + | 1011 | WP_102982364.1 | putative 2-aminoethylphosphonate ABC transporter substrate-binding protein | - |
| GPY16_RS15840 | 190803..191909 | + | 1107 | WP_080533692.1 | putative 2-aminoethylphosphonate ABC transporter ATP-binding protein | - |
| GPY16_RS15845 | 191918..193642 | + | 1725 | WP_158105649.1 | putative 2-aminoethylphosphonate ABC transporter permease subunit | - |
| GPY16_RS15850 | 193652..194356 | + | 705 | WP_011151851.1 | phosphonate utilization transcriptional regulator PhnR | - |
| GPY16_RS15855 | 194476..195378 | + | 903 | WP_158105650.1 | DMT family transporter | - |
| GPY16_RS15860 | 195521..196969 | + | 1449 | WP_193784335.1 | FAD-dependent oxidoreductase | - |
| GPY16_RS15865 | 197086..197964 | + | 879 | WP_158105651.1 | LysR family transcriptional regulator | - |
| GPY16_RS15870 | 198079..198864 | + | 786 | WP_045594833.1 | phosphotransferase | - |
| GPY16_RS15875 | 198954..200438 | - | 1485 | WP_017422478.1 | MFS transporter | - |
| GPY16_RS15880 | 200807..202177 | - | 1371 | WP_158105652.1 | L-serine ammonia-lyase | - |
| GPY16_RS15885 | 202362..203219 | + | 858 | WP_038964789.1 | YdcF family protein | - |
| GPY16_RS15890 | 203385..204317 | + | 933 | WP_038964790.1 | exopolyphosphatase | - |
| GPY16_RS15895 | 204403..204921 | + | 519 | WP_011151870.1 | NUDIX domain-containing protein | - |
| GPY16_RS15900 | 205110..206273 | + | 1164 | WP_172840620.1 | D-alanyl-D-alanine carboxypeptidase | - |
| GPY16_RS15905 | 206327..208813 | - | 2487 | WP_158105653.1 | hypothetical protein | - |
| GPY16_RS15910 | 209313..209978 | + | 666 | WP_086467978.1 | M23 family metallopeptidase | - |
| GPY16_RS15915 | 210253..211101 | - | 849 | WP_011151876.1 | hypothetical protein | - |
| GPY16_RS15920 | 211562..212158 | + | 597 | WP_011151877.1 | transcriptional regulator BetI | - |
| GPY16_RS15925 | 212177..213637 | + | 1461 | WP_158105654.1 | betaine-aldehyde dehydrogenase | - |
| GPY16_RS15930 | 213662..215344 | + | 1683 | WP_058666587.1 | choline dehydrogenase | - |
| GPY16_RS15935 | 215401..216339 | + | 939 | WP_015727669.1 | choline ABC transporter substrate-binding protein | - |
| GPY16_RS15940 | 216395..217237 | + | 843 | WP_011151881.1 | choline ABC transporter permease subunit | - |
| GPY16_RS15945 | 217240..218433 | + | 1194 | WP_158105655.1 | choline ABC transporter ATP-binding protein | - |
| GPY16_RS15950 | 218516..218980 | - | 465 | WP_158105656.1 | DUF417 family protein | - |
| GPY16_RS15955 | 219224..220159 | + | 936 | WP_158105657.1 | hypothetical protein | - |
| GPY16_RS15960 | 220249..222639 | - | 2391 | WP_038963749.1 | phosphoenolpyruvate synthase | - |
| GPY16_RS15965 | 222795..223628 | + | 834 | WP_017422494.1 | kinase/pyrophosphorylase | - |
| GPY16_RS15970 | 223672..224685 | + | 1014 | WP_158105658.1 | DUF2804 domain-containing protein | - |
| GPY16_RS15975 | 224753..225982 | - | 1230 | WP_158105659.1 | proprotein convertase P-domain-containing protein | - |
| GPY16_RS15980 | 226030..226668 | - | 639 | WP_045594825.1 | hypothetical protein | - |
| GPY16_RS15985 | 227099..228742 | + | 1644 | WP_017790731.1 | anaerobic glycerol-3-phosphate dehydrogenase subunit A | - |
| GPY16_RS15990 | 228736..230052 | + | 1317 | WP_130193865.1 | glycerol-3-phosphate dehydrogenase subunit GlpB | - |
| GPY16_RS15995 | 230049..231272 | + | 1224 | WP_158105660.1 | anaerobic glycerol-3-phosphate dehydrogenase subunit C | - |
| GPY16_RS16000 | 231380..231991 | - | 612 | WP_158105661.1 | HAD-IA family hydrolase | - |
| GPY16_RS16005 | 232094..233170 | + | 1077 | WP_158105662.1 | threonine aldolase | - |
| GPY16_RS16010 | 233220..234212 | + | 993 | WP_103163973.1 | LD-carboxypeptidase | - |
| GPY16_RS16015 | 234216..235298 | - | 1083 | WP_158105663.1 | PQQ-dependent sugar dehydrogenase | - |
| GPY16_RS16020 | 235434..236036 | + | 603 | WP_038940096.1 | DUF1294 domain-containing protein | - |
| GPY16_RS16025 | 236118..237266 | - | 1149 | WP_017422506.1 | L-threonine dehydrogenase | - |
| GPY16_RS16030 | 237613..238965 | + | 1353 | WP_038940097.1 | molecular chaperone | - |
| GPY16_RS16035 | 239217..239606 | - | 390 | WP_158105664.1 | rhodanese-like domain-containing protein | - |
| GPY16_RS16040 | 239788..240825 | + | 1038 | WP_158105665.1 | Preprotein translocase subunit SecY | - |
| GPY16_RS16045 | 240929..241132 | + | 204 | WP_158105666.1 | hypothetical protein | - |
| GPY16_RS16050 | 241156..242106 | + | 951 | WP_045589361.1 | SRPBCC family protein | - |
| GPY16_RS16055 | 242103..242609 | + | 507 | WP_038964782.1 | hypothetical protein | - |
| GPY16_RS16060 | 242799..243926 | + | 1128 | WP_158105667.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS16065 | 243926..246976 | + | 3051 | WP_158105668.1 | efflux RND transporter permease subunit | - |
| GPY16_RS16070 | 247120..248391 | + | 1272 | WP_017422515.1 | MgtC/SapB family protein | - |
| GPY16_RS16075 | 248455..250239 | - | 1785 | WP_158105669.1 | M4 family peptidase | - |
| GPY16_RS16080 | 250717..251748 | + | 1032 | WP_158106075.1 | signal recognition particle | - |
| GPY16_RS16085 | 251954..252328 | + | 375 | WP_011151906.1 | PilZ domain-containing protein | - |
| GPY16_RS16090 | 252460..252840 | - | 381 | WP_026050730.1 | STAS/SEC14 domain-containing protein | - |
| GPY16_RS16095 | 253248..254501 | - | 1254 | WP_017422519.1 | septum formation initiator | - |
| GPY16_RS16100 | 254861..255598 | + | 738 | WP_158105670.1 | metallophosphoesterase | - |
| GPY16_RS16105 | 255694..256407 | + | 714 | WP_038940105.1 | sulfite exporter TauE/SafE family protein | - |
| GPY16_RS16110 | 256604..258511 | + | 1908 | WP_038963810.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS16115 | 258573..260252 | + | 1680 | WP_158105671.1 | aspartate aminotransferase family protein | - |
| GPY16_RS16120 | 260353..261810 | - | 1458 | WP_158105672.1 | N-acetylglucosamine-binding protein GbpA | - |
| GPY16_RS16125 | 262318..263217 | + | 900 | WP_103163981.1 | EamA family transporter RarD | - |
| GPY16_RS16130 | 263260..263901 | - | 642 | WP_045609148.1 | START domain-containing protein | - |
| GPY16_RS16135 | 264045..264359 | + | 315 | WP_026050728.1 | N(4)-acetylcytidine aminohydrolase | - |
| GPY16_RS16140 | 264652..265257 | + | 606 | WP_045627970.1 | phosphatase PAP2 family protein | - |
| GPY16_RS16145 | 265370..266368 | - | 999 | WP_045627971.1 | succinylglutamate desuccinylase/aspartoacylase family protein | - |
| GPY16_RS16150 | 266525..268057 | - | 1533 | WP_072599752.1 | putative basic amino acid antiporter YfcC | - |
| GPY16_RS16155 | 268295..269776 | + | 1482 | WP_172665034.1 | coniferyl aldehyde dehydrogenase | - |
| GPY16_RS16160 | 269735..270055 | - | 321 | WP_017422532.1 | cytochrome c | - |
| GPY16_RS16165 | 270128..271135 | - | 1008 | WP_045627972.1 | low-specificity L-threonine aldolase | - |
| GPY16_RS16170 | 271154..271669 | - | 516 | WP_011081043.1 | NUDIX hydrolase | - |
| GPY16_RS16175 | 271945..273612 | + | 1668 | WP_039545353.1 | DUF3763 domain-containing protein | - |
| GPY16_RS16180 | 273622..275067 | + | 1446 | WP_011151925.1 | ATPase RavA stimulator ViaA | - |
| GPY16_RS16185 | 275196..275537 | + | 342 | WP_015727711.1 | MmcQ/YjbR family DNA-binding protein | - |
| GPY16_RS16190 | 275574..276011 | + | 438 | WP_039545351.1 | DUF962 domain-containing protein | - |
| GPY16_RS16195 | 276043..276663 | - | 621 | WP_011081048.1 | LysE family translocator | - |
| GPY16_RS16200 | 276947..277366 | + | 420 | WP_039545349.1 | D-ribose pyranase | - |
| GPY16_RS16205 | 277410..278915 | + | 1506 | WP_039545346.1 | ribose ABC transporter ATP-binding protein RbsA | - |
| GPY16_RS16210 | 278912..279898 | + | 987 | WP_158105673.1 | ribose ABC transporter permease | - |
| GPY16_RS16215 | 279978..280856 | + | 879 | WP_045589348.1 | ribose ABC transporter substrate-binding protein RbsB | - |
| GPY16_RS16220 | 281012..281932 | + | 921 | WP_158105674.1 | ribokinase | - |
| GPY16_RS16225 | 281953..282972 | + | 1020 | WP_039538272.1 | substrate-binding domain-containing protein | - |
| GPY16_RS16235 | 283848..284831 | + | 984 | WP_017422543.1 | chemotaxis protein | - |
| GPY16_RS16240 | 284913..286037 | - | 1125 | WP_170861675.1 | fatty acid desaturase | - |
| GPY16_RS16245 | 286207..286755 | + | 549 | WP_038968439.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS16250 | 286837..287781 | - | 945 | WP_038968440.1 | ribosome biogenesis GTPase YlqF | - |
| GPY16_RS16255 | 288041..289600 | - | 1560 | WP_158105675.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS16260 | 290319..291452 | + | 1134 | WP_017422548.1 | exonuclease SbcCD subunit D | - |
| GPY16_RS16265 | 291461..294526 | + | 3066 | WP_158105676.1 | SMC family ATPase | - |
| GPY16_RS16270 | 295026..298775 | + | 3750 | WP_158106076.1 | M6 family metalloprotease domain-containing protein | - |
| GPY16_RS16275 | 299296..300147 | + | 852 | WP_015727729.1 | LysR family transcriptional regulator | - |
| GPY16_RS16280 | 300151..300591 | - | 441 | WP_017422552.1 | prepilin peptidase | - |
| GPY16_RS16285 | 300791..301006 | + | 216 | WP_039545336.1 | Flp family type IVb pilin | - |
| GPY16_RS16290 | 301078..301851 | + | 774 | WP_158105677.1 | pilus assembly protein CpaB | - |
| GPY16_RS16295 | 301854..303179 | + | 1326 | WP_158105678.1 | pilus assembly protein N-terminal domain-containing protein | - |
| GPY16_RS16300 | 303179..303640 | + | 462 | WP_011081074.1 | hypothetical protein | - |
| GPY16_RS16305 | 303640..304842 | + | 1203 | WP_158105679.1 | type II secretion protein | - |
| GPY16_RS16310 | 304839..306104 | + | 1266 | WP_017422557.1 | CpaF family protein | - |
| GPY16_RS16315 | 306101..307018 | + | 918 | WP_158105680.1 | type II secretion system F family protein | - |
| GPY16_RS16320 | 307015..307887 | + | 873 | WP_039545327.1 | type II secretion system F family protein | - |
| GPY16_RS16325 | 307887..309017 | + | 1131 | WP_158105681.1 | tetratricopeptide repeat protein | - |
| GPY16_RS16330 | 309014..309541 | + | 528 | WP_058666620.1 | pilus assembly protein | - |
| GPY16_RS16335 | 309531..310112 | + | 582 | WP_086468012.1 | pilus assembly protein TadF | - |
| GPY16_RS16340 | 310066..311349 | + | 1284 | WP_039545319.1 | VWA domain-containing protein | - |
| GPY16_RS16345 | 311321..311917 | + | 597 | WP_045594795.1 | OmpA family protein | - |
| GPY16_RS16350 | 312157..312537 | - | 381 | WP_158105682.1 | pyruvate dehydrogenase | - |
| GPY16_RS16355 | 312702..313628 | + | 927 | WP_158105683.1 | endonuclease/exonuclease/phosphatase family protein | - |
| GPY16_RS16370 | 314232..314486 | + | 255 | WP_017422567.1 | hypothetical protein | - |
| GPY16_RS16375 | 314552..315340 | - | 789 | WP_039453327.1 | lipase | - |
| GPY16_RS16380 | 315457..316860 | - | 1404 | WP_015727792.1 | anion permease | - |
| GPY16_RS16385 | 317137..318696 | + | 1560 | WP_158105684.1 | sensor histidine kinase | - |
| GPY16_RS16390 | 318699..319373 | + | 675 | WP_199245047.1 | response regulator | - |
| GPY16_RS16395 | 319515..320126 | + | 612 | WP_039562798.1 | sugar O-acetyltransferase | - |
| GPY16_RS16400 | 320187..320642 | - | 456 | WP_045590278.1 | NUDIX domain-containing protein | - |
| GPY16_RS16405 | 320658..321029 | - | 372 | WP_039452168.1 | nucleotide pyrophosphohydrolase | - |
| GPY16_RS16410 | 321212..321487 | + | 276 | WP_158105686.1 | nitrogen fixation protein NifW | - |
| GPY16_RS22460 | 321489..321755 | - | 267 | WP_038940151.1 | hypothetical protein | - |
| GPY16_RS16415 | 321987..322922 | + | 936 | WP_038964234.1 | iron chelate uptake ABC transporter permease subunit VctD | - |
| GPY16_RS16420 | 322915..323865 | + | 951 | WP_039466650.1 | iron chelate uptake ABC transporter family permease subunit | - |
| GPY16_RS16425 | 323873..324628 | + | 756 | WP_045590276.1 | iron chelate ABC transporter ATP-binding protein VctC | - |
| GPY16_RS16430 | 324679..325065 | - | 387 | WP_017422578.1 | Cu(I)-responsive transcriptional regulator | - |
| GPY16_RS16435 | 325252..325500 | - | 249 | WP_017422580.1 | YgjV family protein | - |
| GPY16_RS16440 | 325848..326114 | + | 267 | WP_038964226.1 | hypothetical protein | - |
| GPY16_RS16445 | 326210..327469 | - | 1260 | WP_130199779.1 | hydroxymethylglutaryl-CoA reductase | - |
| GPY16_RS16450 | 327549..327845 | - | 297 | WP_038940159.1 | hypothetical protein | - |
| GPY16_RS16455 | 327941..328144 | - | 204 | WP_017422584.1 | hypothetical protein | - |
| GPY16_RS16460 | 328323..330476 | - | 2154 | WP_017422585.1 | TIGR01666 family membrane protein | - |
| GPY16_RS16465 | 330685..332756 | + | 2072 | Protein_282 | DNA helicase IV | - |
| GPY16_RS16470 | 332895..333350 | - | 456 | WP_017422587.1 | methylglyoxal synthase | - |
| GPY16_RS16475 | 333407..334420 | - | 1014 | WP_045609747.1 | TMAO reductase system periplasmic protein TorT | - |
| GPY16_RS16480 | 334531..337443 | + | 2913 | WP_165386610.1 | TMAO reductase system sensor histidine kinase/response regulator TorS | - |
| GPY16_RS16485 | 337523..337708 | - | 186 | WP_011081109.1 | hypothetical protein | - |
| GPY16_RS16490 | 337735..340089 | - | 2355 | WP_158105687.1 | fatty acid cis/trans isomerase | - |
| GPY16_RS16495 | 340920..342017 | + | 1098 | WP_017422591.1 | PEGA domain-containing protein | - |
| GPY16_RS16500 | 342096..343907 | + | 1812 | WP_026050714.1 | SUMF1/EgtB/PvdO family nonheme iron enzyme | - |
| GPY16_RS16505 | 344211..344768 | - | 558 | WP_039466632.1 | NapC/NirT family cytochrome c | - |
| GPY16_RS16510 | 344795..345418 | - | 624 | WP_103189311.1 | c-type cytochrome | - |
| GPY16_RS16515 | 346115..348319 | + | 2205 | WP_199245048.1 | OmcA/MtrC family decaheme c-type cytochrome | - |
| GPY16_RS16520 | 348372..349343 | + | 972 | WP_158105689.1 | DmsE family decaheme c-type cytochrome | - |
| GPY16_RS16525 | 349354..351336 | + | 1983 | WP_158105690.1 | MtrB/PioB family decaheme-associated outer membrane protein | - |
| GPY16_RS16530 | 351458..352837 | - | 1380 | WP_158105691.1 | ATP-dependent RNA helicase DbpA | - |
| GPY16_RS16535 | 353042..356712 | + | 3671 | Protein_296 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS16540 | 356716..358482 | + | 1767 | WP_158105692.1 | EAL domain-containing protein | - |
| GPY16_RS16545 | 358505..360151 | + | 1647 | WP_199245049.1 | response regulator | - |
| GPY16_RS16550 | 360308..360541 | + | 234 | WP_017422602.1 | hypothetical protein | - |
| GPY16_RS16555 | 360648..362540 | - | 1893 | WP_199245050.1 | EAL domain-containing protein | - |
| GPY16_RS16560 | 363375..366863 | + | 3489 | WP_158105695.1 | cell surface protein | - |
| GPY16_RS16565 | 366952..367779 | - | 828 | WP_158105696.1 | phosphate ABC transporter substrate-binding protein | - |
| GPY16_RS16570 | 367997..368353 | + | 357 | WP_017422948.1 | DUF3024 domain-containing protein | - |
| GPY16_RS16575 | 368409..369221 | - | 813 | WP_026050868.1 | AraC family transcriptional regulator | - |
| GPY16_RS16580 | 369351..371345 | - | 1995 | WP_158105697.1 | exoribonuclease II | - |
| GPY16_RS16585 | 371723..373648 | + | 1926 | WP_011081129.1 | DEAD/DEAH box helicase | - |
| GPY16_RS16590 | 373990..375183 | + | 1194 | WP_158105698.1 | acetate/propionate family kinase | - |
| GPY16_RS16595 | 375332..376897 | - | 1566 | WP_086468026.1 | arylsulfatase | - |
| GPY16_RS16600 | 377169..378038 | - | 870 | WP_158105699.1 | LysR family transcriptional regulator | - |
| GPY16_RS16605 | 378161..379678 | + | 1518 | WP_158105700.1 | arylsulfatase | - |
| GPY16_RS16610 | 379775..381079 | + | 1305 | WP_158105701.1 | anaerobic sulfatase maturase | - |
| GPY16_RS16615 | 381185..382168 | + | 984 | WP_158105702.1 | MoxR family ATPase | - |
| GPY16_RS16620 | 382180..383142 | + | 963 | WP_158105703.1 | DUF58 domain-containing protein | - |
| GPY16_RS16625 | 383143..383694 | + | 552 | WP_038963828.1 | DUF4381 domain-containing protein | - |
| GPY16_RS16630 | 383687..384775 | + | 1089 | WP_158105704.1 | VWA domain-containing protein | - |
| GPY16_RS16635 | 384750..386507 | + | 1758 | WP_158105705.1 | VWA domain-containing protein | - |
| GPY16_RS16640 | 386504..387835 | + | 1332 | WP_158105706.1 | BatD family protein | - |
| GPY16_RS16645 | 388108..389013 | + | 906 | WP_039545597.1 | LysR family transcriptional regulator | - |
| GPY16_RS16650 | 389125..390825 | - | 1701 | WP_045589115.1 | alkaline phosphatase family protein | - |
| GPY16_RS16655 | 390850..391635 | - | 786 | WP_103195538.1 | SUMF1/EgtB/PvdO family nonheme iron enzyme | - |
| GPY16_RS16660 | 391800..393122 | + | 1323 | WP_130197671.1 | anaerobic sulfatase maturase | - |
| GPY16_RS16665 | 393143..394213 | + | 1071 | WP_158105707.1 | tetratricopeptide repeat protein | - |
| GPY16_RS16670 | 394210..395838 | - | 1629 | WP_158105708.1 | VRR-NUC domain-containing protein | - |
| GPY16_RS16675 | 395906..397138 | - | 1233 | WP_158105709.1 | OFA family MFS transporter | - |
| GPY16_RS16680 | 397714..398070 | + | 357 | WP_011081148.1 | hypothetical protein | - |
| GPY16_RS16685 | 398624..398821 | + | 198 | WP_011152019.1 | hypothetical protein | - |
| GPY16_RS16690 | 398941..400428 | - | 1488 | WP_039448276.1 | multidrug efflux MFS transporter | - |
| GPY16_RS16695 | 400439..401464 | - | 1026 | WP_158105710.1 | HlyD family secretion protein | - |
| GPY16_RS16700 | 401711..402271 | - | 561 | WP_199245051.1 | MarR family transcriptional regulator | - |
| GPY16_RS16705 | 402391..403143 | + | 753 | WP_046030097.1 | hypothetical protein | - |
| GPY16_RS16710 | 403201..403461 | + | 261 | WP_158105711.1 | DUF2024 family protein | - |
| GPY16_RS16715 | 403619..404725 | + | 1107 | WP_158105712.1 | Fic family protein | - |
| GPY16_RS16720 | 404834..405094 | + | 261 | WP_011081156.1 | DUF5062 family protein | - |
| GPY16_RS16725 | 405217..405675 | + | 459 | WP_158105713.1 | exoribonuclease R | - |
| GPY16_RS16730 | 405865..406611 | + | 747 | WP_086468035.1 | carbon-nitrogen hydrolase family protein | - |
| GPY16_RS16735 | 406598..406792 | - | 195 | WP_130193818.1 | hypothetical protein | - |
| GPY16_RS16740 | 407112..407876 | + | 765 | WP_158105714.1 | nucleotidyltransferase domain-containing protein | - |
| GPY16_RS16745 | 407932..409692 | - | 1761 | WP_158105715.1 | ABC transporter ATP-binding protein/permease | - |
| GPY16_RS16750 | 410046..413855 | + | 3810 | WP_165387660.1 | SIR2 family protein | - |
| GPY16_RS16755 | 414017..416881 | - | 2865 | WP_158105716.1 | aminomethyl-transferring glycine dehydrogenase | - |
| GPY16_RS16760 | 416986..417366 | - | 381 | WP_011081167.1 | glycine cleavage system protein GcvH | - |
| GPY16_RS16765 | 417409..418704 | - | 1296 | WP_038964112.1 | serine hydroxymethyltransferase | - |
| GPY16_RS16770 | 419088..419711 | + | 624 | WP_011081169.1 | XRE family transcriptional regulator | - |
| GPY16_RS16775 | 420002..421135 | + | 1134 | WP_045609920.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GPY16_RS16780 | 421222..422316 | + | 1095 | WP_072601296.1 | trypsin-like serine protease | - |
| GPY16_RS16785 | 422306..423031 | - | 726 | WP_017790859.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS16790 | 423192..424265 | + | 1074 | WP_097352633.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS16795 | 424265..425335 | + | 1071 | WP_158105717.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS16800 | 425332..428391 | + | 3060 | WP_158105718.1 | efflux RND transporter permease subunit | - |
| GPY16_RS16805 | 428551..429126 | - | 576 | WP_038964119.1 | porin family protein | - |
| GPY16_RS16810 | 429403..431130 | - | 1728 | WP_158105719.1 | PTS fructose transporter subunit IIBC | - |
| GPY16_RS16815 | 431150..432127 | - | 978 | WP_158105720.1 | 1-phosphofructokinase | - |
| GPY16_RS16820 | 432137..433279 | - | 1143 | WP_158105721.1 | fused PTS fructose transporter subunit IIA/HPr protein | - |
| GPY16_RS16825 | 433724..434704 | + | 981 | WP_045594736.1 | catabolite repressor/activator | - |
| GPY16_RS16830 | 434730..435698 | - | 969 | WP_158105722.1 | endonuclease/exonuclease/phosphatase family protein | - |
| GPY16_RS16835 | 435711..436523 | - | 813 | WP_086468047.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS16840 | 436669..437223 | + | 555 | WP_017422898.1 | RNA-binding S4 domain-containing protein | - |
| GPY16_RS16845 | 437314..438141 | - | 828 | WP_038968680.1 | EAL domain-containing protein | - |
| GPY16_RS16850 | 438465..439934 | - | 1470 | WP_026050855.1 | pyruvate kinase | - |
| GPY16_RS16855 | 440010..441389 | - | 1380 | WP_038941005.1 | MFS transporter | - |
| GPY16_RS16860 | 441668..442969 | + | 1302 | WP_094866526.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS16865 | 442969..445332 | + | 2364 | WP_158105723.1 | HAMP domain-containing protein | - |
| GPY16_RS16870 | 445322..446590 | + | 1269 | WP_176463371.1 | sigma-54 dependent transcriptional regulator | - |
| GPY16_RS16875 | 446649..447797 | - | 1149 | WP_045628080.1 | iron-containing alcohol dehydrogenase | - |
| GPY16_RS16880 | 447920..448798 | + | 879 | WP_017422889.1 | AraC family transcriptional regulator | - |
| GPY16_RS16885 | 449167..452349 | + | 3183 | WP_158105724.1 | chitinase C-terminal domain-containing protein | - |
| GPY16_RS16890 | 452425..453639 | - | 1215 | WP_158105725.1 | glucose-1-phosphate adenylyltransferase | - |
| GPY16_RS16895 | 454070..455818 | - | 1749 | WP_158105726.1 | formate--tetrahydrofolate ligase | - |
| GPY16_RS16900 | 456000..457304 | - | 1305 | WP_011081195.1 | inosine/guanosine kinase | - |
| GPY16_RS16905 | 457429..457914 | - | 486 | WP_011081196.1 | CreA family protein | - |
| GPY16_RS16910 | 458219..458722 | + | 504 | WP_039538034.1 | hypothetical protein | - |
| GPY16_RS16915 | 458783..460558 | + | 1776 | WP_130359860.1 | HD domain-containing protein | - |
| GPY16_RS16920 | 460715..461383 | + | 669 | WP_038941015.1 | HAD-IA family hydrolase | - |
| GPY16_RS16925 | 461860..463293 | - | 1434 | WP_038963374.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS16930 | 463647..464240 | + | 594 | WP_158105727.1 | DUF479 domain-containing protein | - |
| GPY16_RS16935 | 464295..465551 | + | 1257 | WP_039449854.1 | DEAD/DEAH box helicase | - |
| GPY16_RS16940 | 465652..466455 | - | 804 | WP_199245052.1 | EAL domain-containing protein | - |
| GPY16_RS16945 | 466751..467383 | - | 633 | WP_017422876.1 | hypothetical protein | - |
| GPY16_RS16950 | 467745..468284 | + | 540 | WP_102982273.1 | cytochrome b | - |
| GPY16_RS16955 | 468281..468850 | + | 570 | WP_158105729.1 | YceI family protein | - |
| GPY16_RS16960 | 468955..470405 | - | 1451 | Protein_381 | formate transporter FocA | - |
| GPY16_RS16965 | 470657..471562 | + | 906 | WP_011081208.1 | LysR family transcriptional regulator | - |
| GPY16_RS16970 | 471759..472232 | + | 474 | WP_026050850.1 | DUF1097 domain-containing protein | - |
| GPY16_RS16975 | 472435..474066 | - | 1632 | WP_017422871.1 | ATP-dependent endonuclease | - |
| GPY16_RS16980 | 474305..476050 | + | 1746 | WP_199245053.1 | bifunctional metallophosphatase/5'-nucleotidase | - |
| GPY16_RS16985 | 476576..477597 | + | 1022 | Protein_386 | TerC/Alx family metal homeostasis membrane protein | - |
| GPY16_RS16990 | 477882..478073 | + | 192 | WP_011081213.1 | hypothetical protein | - |
| GPY16_RS16995 | 478227..479123 | + | 897 | WP_053542402.1 | DMT family transporter | - |
| GPY16_RS17000 | 479384..480517 | + | 1134 | WP_158106078.1 | arginase family protein | - |
| GPY16_RS17005 | 480551..480916 | + | 366 | WP_158105731.1 | nuclear transport factor 2 family protein | - |
| GPY16_RS17010 | 480968..481525 | - | 558 | WP_017422863.1 | PhnA domain-containing protein | - |
| GPY16_RS17015 | 481742..484216 | - | 2475 | WP_158105732.1 | fumarate hydrolyase | - |
| GPY16_RS17020 | 484239..485486 | - | 1248 | WP_039545039.1 | outer membrane protein transport protein | - |
| GPY16_RS17025 | 485862..486944 | + | 1083 | WP_045609896.1 | site-2 protease family protein | - |
| GPY16_RS17030 | 487016..487819 | - | 804 | WP_017790897.1 | M48 family metallopeptidase | - |
| GPY16_RS17035 | 487875..488309 | + | 435 | WP_011081222.1 | hotdog fold thioesterase | - |
| GPY16_RS17040 | 488311..488547 | + | 237 | WP_158105733.1 | DUF3389 domain-containing protein | - |
| GPY16_RS17045 | 488621..490312 | + | 1692 | WP_017422858.1 | SgrR family transcriptional regulator | - |
| GPY16_RS17050 | 490312..490563 | + | 252 | WP_017790901.1 | hypothetical protein | - |
| GPY16_RS17055 | 490606..492240 | - | 1635 | WP_158105734.1 | alpha-glucosidase | - |
| GPY16_RS17060 | 492458..493372 | + | 915 | WP_039537990.1 | LysR family transcriptional regulator | - |
| GPY16_RS17065 | 493365..493706 | + | 342 | WP_011152092.1 | divalent-cation tolerance protein CutA | - |
| GPY16_RS17070 | 493662..494258 | - | 597 | WP_026050845.1 | DUF2238 domain-containing protein | - |
| GPY16_RS17075 | 494559..495398 | + | 840 | WP_017422854.1 | isopenicillin N synthase family oxygenase | - |
| GPY16_RS17080 | 495558..496172 | + | 615 | WP_038941035.1 | DnaJ domain-containing protein | - |
| GPY16_RS17085 | 496203..496760 | - | 558 | WP_158105735.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS17090 | 496845..498500 | - | 1656 | WP_046030517.1 | ABC-ATPase domain-containing protein | - |
| GPY16_RS17095 | 498619..500535 | - | 1917 | WP_039560635.1 | EAL domain-containing protein | - |
| GPY16_RS17100 | 500708..501910 | - | 1203 | WP_017790907.1 | trans-2-enoyl-CoA reductase family protein | - |
| GPY16_RS17105 | 501989..502591 | - | 603 | WP_038941043.1 | multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 | - |
| GPY16_RS17110 | 502590..503267 | + | 678 | WP_103182223.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS17115 | 503269..505710 | + | 2442 | WP_199245054.1 | FtsX-like permease family protein | - |
| GPY16_RS17120 | 506030..507475 | + | 1446 | WP_158105736.1 | FAD-dependent oxidoreductase | - |
| GPY16_RS17125 | 507489..508424 | - | 936 | WP_045589178.1 | biotin-dependent carboxyltransferase family protein | - |
| GPY16_RS17130 | 508421..509104 | - | 684 | WP_158105737.1 | allophanate hydrolase subunit 1 | - |
| GPY16_RS17135 | 509114..509872 | - | 759 | WP_045612635.1 | LamB/YcsF family protein | - |
| GPY16_RS17140 | 510022..510609 | + | 588 | WP_017422841.1 | YfiR family protein | - |
| GPY16_RS17145 | 510597..512585 | + | 1989 | WP_158105738.1 | diguanylate cyclase | - |
| GPY16_RS17150 | 512870..515008 | - | 2139 | WP_158105739.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| GPY16_RS17155 | 515237..516124 | + | 888 | WP_026130869.1 | LysR family transcriptional regulator | - |
| GPY16_RS17160 | 516173..518851 | - | 2679 | WP_158105740.1 | bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase | - |
| GPY16_RS17165 | 519076..519651 | + | 576 | WP_017422835.1 | SPOR domain-containing protein | - |
| GPY16_RS17170 | 519818..520813 | + | 996 | WP_039449928.1 | D-alanine--D-alanine ligase | - |
| GPY16_RS17175 | 521110..521484 | + | 375 | WP_017790922.1 | DUF3319 domain-containing protein | - |
| GPY16_RS17180 | 521487..521798 | + | 312 | WP_017422832.1 | stress response translation initiation inhibitor YciH | - |
| GPY16_RS17185 | 523066..523221 | - | 156 | WP_011152125.1 | YoaH family protein | - |
| GPY16_RS17190 | 523266..524375 | - | 1110 | WP_039452246.1 | conjugal transfer protein TraF | - |
| GPY16_RS17195 | 524439..525320 | - | 882 | WP_039546459.1 | DUF2861 family protein | - |
| GPY16_RS17200 | 525320..525982 | - | 663 | WP_017422829.1 | response regulator transcription factor | - |
| GPY16_RS17205 | 525957..527408 | - | 1452 | WP_039537878.1 | sensor histidine kinase | - |
| GPY16_RS17210 | 527555..528949 | - | 1395 | WP_017422827.1 | Re/Si-specific NAD(P)(+) transhydrogenase subunit beta | - |
| GPY16_RS17215 | 528963..530519 | - | 1557 | WP_026050840.1 | Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha | - |
| GPY16_RS17220 | 530825..531106 | - | 282 | WP_017422825.1 | transcriptional activator HlyU | - |
| GPY16_RS17225 | 531113..531487 | - | 375 | WP_017422824.1 | late competence development ComFB family protein | - |
| GPY16_RS17230 | 531694..532938 | + | 1245 | WP_038941058.1 | GGDEF domain-containing protein | - |
| GPY16_RS17235 | 532989..533984 | - | 996 | WP_158105741.1 | Solitary outer membrane autotransporter beta-barrel domain | - |
| GPY16_RS17240 | 533987..534946 | - | 960 | WP_017422821.1 | diguanylate cyclase | - |
| GPY16_RS17245 | 535086..535523 | + | 438 | WP_011081285.1 | DUF3069 domain-containing protein | - |
| GPY16_RS17250 | 535560..536042 | - | 483 | WP_039547087.1 | MarR family transcriptional regulator | - |
| GPY16_RS17255 | 536153..537067 | + | 915 | WP_046030567.1 | EamA family transporter | - |
| GPY16_RS17260 | 537078..538184 | - | 1107 | WP_046030568.1 | molybdenum ABC transporter ATP-binding protein ModC | - |
| GPY16_RS17265 | 538184..538870 | - | 687 | WP_038941062.1 | molybdate ABC transporter permease subunit | - |
| GPY16_RS17270 | 538867..539622 | - | 756 | WP_045628098.1 | molybdate ABC transporter substrate-binding protein | - |
| GPY16_RS17275 | 539633..541084 | - | 1452 | WP_158105742.1 | cobyric acid synthase | - |
| GPY16_RS17280 | 541239..541607 | + | 369 | WP_158105743.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
| GPY16_RS17285 | 541878..542414 | + | 537 | WP_017422814.1 | hypothetical protein | - |
| GPY16_RS17290 | 542534..543151 | - | 618 | WP_158105744.1 | ATP-dependent zinc protease | - |
| GPY16_RS17295 | 543165..544352 | - | 1188 | WP_011152202.1 | aspartate/tyrosine/aromatic aminotransferase | - |
| GPY16_RS17300 | 544563..546875 | - | 2313 | WP_158105745.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS17305 | 547090..547557 | - | 468 | WP_045589294.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| GPY16_RS17310 | 547632..549752 | - | 2121 | WP_017422810.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| GPY16_RS17315 | 550049..550942 | + | 894 | WP_046030155.1 | endonuclease/exonuclease/phosphatase family protein | - |
| GPY16_RS17320 | 551127..554276 | - | 3150 | WP_158105746.1 | efflux RND transporter permease subunit | - |
| GPY16_RS17325 | 554278..555282 | - | 1005 | WP_158105747.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS17330 | 555321..555788 | - | 468 | WP_158105748.1 | YeeE/YedE family protein | - |
| GPY16_RS17335 | 555797..556219 | - | 423 | WP_158105749.1 | YeeE/YedE family protein | - |
| GPY16_RS17340 | 556235..556546 | - | 312 | WP_038941075.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| GPY16_RS17345 | 556699..556884 | + | 186 | WP_011081305.1 | DUF2892 domain-containing protein | - |
| GPY16_RS17350 | 556970..558673 | + | 1704 | WP_038941076.1 | FAD-dependent oxidoreductase | - |
| GPY16_RS17355 | 559000..560565 | + | 1566 | WP_158105750.1 | DUF1800 domain-containing protein | - |
| GPY16_RS17360 | 560576..561892 | + | 1317 | WP_130251194.1 | DUF1501 domain-containing protein | - |
| GPY16_RS17365 | 561963..563051 | - | 1089 | WP_158105751.1 | ketoacyl-ACP synthase III | - |
| GPY16_RS17370 | 563346..563780 | + | 435 | WP_045628114.1 | thioredoxin TrxC | - |
| GPY16_RS17375 | 563979..565133 | + | 1155 | WP_038941081.1 | MFS transporter | - |
| GPY16_RS17380 | 565139..566023 | - | 885 | WP_045594680.1 | AraC family transcriptional regulator | - |
| GPY16_RS17385 | 566075..567460 | + | 1386 | WP_038941082.1 | MATE family efflux transporter | - |
| GPY16_RS17390 | 567429..567854 | - | 426 | WP_038941083.1 | nitrous oxide-stimulated promoter family protein | - |
| GPY16_RS17395 | 567962..568165 | + | 204 | WP_017789168.1 | DUF2986 domain-containing protein | - |
| GPY16_RS17400 | 568246..569862 | - | 1617 | WP_017422794.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS17405 | 570368..571696 | + | 1329 | WP_026050833.1 | anaerobic C4-dicarboxylate transporter | - |
| GPY16_RS17410 | 571797..573074 | - | 1278 | WP_103154768.1 | tetratricopeptide repeat protein | - |
| GPY16_RS17415 | 573074..573712 | - | 639 | WP_158105752.1 | energy transducer TonB | - |
| GPY16_RS17420 | 573712..574116 | - | 405 | WP_017422790.1 | biopolymer transporter ExbD | - |
| GPY16_RS17425 | 574113..574670 | - | 558 | WP_026050832.1 | MotA/TolQ/ExbB proton channel family protein | - |
| GPY16_RS17430 | 574676..576043 | - | 1368 | WP_158105753.1 | MotA/TolQ/ExbB proton channel family protein | - |
| GPY16_RS17435 | 576044..576811 | - | 768 | WP_039537792.1 | DUF3450 domain-containing protein | - |
| GPY16_RS17440 | 577077..577565 | - | 489 | WP_038941090.1 | NYN domain-containing protein | - |
| GPY16_RS17445 | 577691..578122 | + | 432 | WP_045589318.1 | DUF4174 domain-containing protein | - |
| GPY16_RS17450 | 578129..578887 | - | 759 | WP_026050831.1 | uroporphyrinogen-III C-methyltransferase | - |
| GPY16_RS17455 | 579064..579921 | - | 858 | WP_158105754.1 | formate/nitrite transporter family protein | - |
| GPY16_RS17460 | 580074..580397 | - | 324 | WP_011081328.1 | nitrite reductase small subunit NirD | - |
| GPY16_RS17465 | 580412..582973 | - | 2562 | WP_011081329.1 | nitrite reductase large subunit NirB | - |
| GPY16_RS17470 | 583482..585026 | + | 1545 | WP_158105755.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS17475 | 585092..587983 | - | 2892 | WP_158105756.1 | hypothetical protein | - |
| GPY16_RS17485 | 588478..588720 | - | 243 | WP_039537775.1 | hypothetical protein | - |
| GPY16_RS17490 | 588949..589626 | - | 678 | WP_017422777.1 | MaoC family dehydratase | - |
| GPY16_RS17495 | 590123..594241 | + | 4119 | WP_158106080.1 | response regulator | - |
| GPY16_RS17500 | 594243..595082 | + | 840 | WP_011081335.1 | protein-glutamate O-methyltransferase CheR | - |
| GPY16_RS17505 | 595085..595666 | + | 582 | WP_017422775.1 | chemotaxis protein CheB | - |
| GPY16_RS17510 | 595669..596685 | + | 1017 | WP_011081337.1 | diguanylate cyclase | - |
| GPY16_RS17515 | 596915..597649 | + | 735 | WP_026050830.1 | IclR family transcriptional regulator | - |
| GPY16_RS17520 | 597657..598493 | + | 837 | WP_170937690.1 | arginase family protein | - |
| GPY16_RS17525 | 598537..599820 | - | 1284 | WP_026130874.1 | DEAD/DEAH box helicase | - |
| GPY16_RS17530 | 600178..603165 | + | 2988 | WP_158105757.1 | MSHA biogenesis protein MshQ | - |
| GPY16_RS17535 | 603222..604208 | - | 987 | WP_011152241.1 | GTP-binding protein | - |
| GPY16_RS17540 | 604360..605037 | + | 678 | WP_158105758.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| GPY16_RS17545 | 605070..607034 | - | 1965 | WP_158105759.1 | diguanylate cyclase | - |
| GPY16_RS17550 | 607443..610565 | + | 3123 | WP_158105760.1 | thrombospondin type 3 repeat-containing protein | - |
| GPY16_RS17555 | 610658..610981 | - | 324 | WP_038941106.1 | nitrite reductase small subunit NirD | - |
| GPY16_RS17560 | 610985..613468 | - | 2484 | WP_158105761.1 | nitrite reductase large subunit NirB | - |
| GPY16_RS17565 | 613479..614321 | - | 843 | WP_039537748.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS17570 | 614333..615301 | - | 969 | WP_158105762.1 | ABC transporter permease | - |
| GPY16_RS17575 | 615329..616651 | - | 1323 | WP_026050826.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS17580 | 616969..617553 | - | 585 | WP_017422762.1 | ANTAR domain-containing protein | - |
| GPY16_RS17585 | 617723..618631 | - | 909 | WP_045594664.1 | dienelactone hydrolase family protein | - |
| GPY16_RS17590 | 618762..619727 | - | 966 | WP_158105763.1 | glycosyl transferase family protein | - |
| GPY16_RS17595 | 619806..620699 | - | 894 | WP_158105764.1 | uroporphyrinogen-III C-methyltransferase | - |
| GPY16_RS17600 | 620726..623371 | - | 2646 | WP_158105765.1 | nitrate reductase | - |
| GPY16_RS17605 | 623590..624060 | - | 471 | WP_039446841.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS17610 | 624428..625828 | + | 1401 | WP_158105766.1 | alpha-amylase family protein | - |
| GPY16_RS17615 | 625914..627803 | - | 1890 | WP_017422755.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS17620 | 628000..629886 | - | 1887 | WP_158105767.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS17625 | 630616..631167 | + | 552 | WP_017422754.1 | hypothetical protein | - |
| GPY16_RS17630 | 631169..632584 | + | 1416 | WP_017422753.1 | leukocidin family pore-forming toxin | - |
| GPY16_RS17635 | 633028..634404 | + | 1377 | WP_017422752.1 | glycerol-3-phosphate transporter | - |
| GPY16_RS17640 | 634655..635713 | + | 1059 | WP_017422751.1 | glycerophosphodiester phosphodiesterase | - |
| GPY16_RS17645 | 635982..637367 | + | 1386 | WP_103164067.1 | TldD/PmbA family protein | - |
| GPY16_RS17650 | 637367..638710 | + | 1344 | WP_039466374.1 | TldD/PmbA family protein | - |
| GPY16_RS17655 | 638950..639504 | + | 555 | WP_038941124.1 | type II secretion system GspH family protein | - |
| GPY16_RS17660 | 639903..641270 | + | 1368 | WP_026050821.1 | anaerobic C4-dicarboxylate transporter DcuC | - |
| GPY16_RS17665 | 641474..642064 | + | 591 | WP_017422746.1 | LemA family protein | - |
| GPY16_RS17670 | 642064..643917 | + | 1854 | WP_158105768.1 | M48 family metallopeptidase | - |
| GPY16_RS17675 | 644260..645624 | + | 1365 | WP_199245055.1 | endonuclease/exonuclease/phosphatase family protein | - |
| GPY16_RS17680 | 646267..646776 | - | 510 | WP_158106081.1 | RHS repeat-associated core domain-containing protein | - |
| GPY16_RS17685 | 646880..647380 | - | 501 | WP_158105770.1 | hypothetical protein | - |
| GPY16_RS17690 | 647399..648151 | - | 753 | WP_039537697.1 | immunity 49 family protein | - |
| GPY16_RS22465 | 648162..648845 | - | 684 | WP_199245056.1 | hypothetical protein | - |
| GPY16_RS17700 | 648876..649565 | - | 690 | Protein_528 | RHS domain-containing protein | - |
| GPY16_RS17705 | 649598..650429 | - | 832 | Protein_529 | ankyrin repeat domain-containing protein | - |
| GPY16_RS17710 | 650688..651374 | - | 687 | WP_039537695.1 | DUF1851 domain-containing protein | - |
| GPY16_RS22470 | 651376..651948 | - | 573 | WP_080527329.1 | hypothetical protein | - |
| GPY16_RS22475 | 651970..652200 | - | 231 | Protein_532 | hypothetical protein | - |
| GPY16_RS17715 | 652255..655791 | - | 3537 | Protein_533 | RHS repeat protein | - |
| GPY16_RS17720 | 655792..656700 | - | 909 | WP_039537692.1 | hypothetical protein | - |
| GPY16_RS17725 | 656701..656991 | - | 291 | WP_130311937.1 | PAAR domain-containing protein | - |
| GPY16_RS17730 | 657001..658836 | - | 1836 | WP_158105772.1 | type VI secretion system tip protein VgrG | - |
| GPY16_RS17735 | 658891..659370 | - | 480 | WP_011081383.1 | type VI secretion system tube protein Hcp | - |
| GPY16_RS17740 | 659586..662150 | - | 2565 | WP_158105773.1 | type VI secretion system ATPase TssH | - |
| GPY16_RS17745 | 662164..663132 | - | 969 | WP_158106083.1 | type VI secretion system baseplate subunit TssG | - |
| GPY16_RS17750 | 663129..664955 | - | 1827 | WP_038963287.1 | type VI secretion system baseplate subunit TssF | - |
| GPY16_RS17755 | 664952..665425 | - | 474 | WP_038963288.1 | type VI secretion system baseplate subunit TssE | - |
| GPY16_RS17760 | 665422..666225 | - | 804 | WP_038941140.1 | protein of avirulence locus | - |
| GPY16_RS17765 | 666236..667843 | - | 1608 | WP_045589492.1 | type VI secretion system contractile sheath large subunit | - |
| GPY16_RS17770 | 667774..669267 | - | 1494 | WP_102982213.1 | type VI secretion system contractile sheath large subunit | - |
| GPY16_RS17775 | 669279..669791 | - | 513 | WP_011081391.1 | type VI secretion system contractile sheath small subunit | - |
| GPY16_RS17780 | 669808..670941 | - | 1134 | WP_158105774.1 | type VI secretion system protein TssA | - |
| GPY16_RS17785 | 670941..671735 | - | 795 | WP_026130879.1 | protein phosphatase 2C domain-containing protein | - |
| GPY16_RS17790 | 671746..672441 | - | 696 | WP_046030039.1 | type VI secretion system-associated protein TagF | - |
| GPY16_RS17795 | 672423..675947 | - | 3525 | WP_158105775.1 | type VI secretion system membrane subunit TssM | - |
| GPY16_RS17800 | 675925..677253 | - | 1329 | WP_038963293.1 | type VI secretion system protein TssL, long form | - |
| GPY16_RS17805 | 677262..678584 | - | 1323 | WP_158105776.1 | type VI secretion system baseplate subunit TssK | - |
| GPY16_RS17810 | 678608..679063 | - | 456 | WP_017422721.1 | type VI secretion system lipoprotein TssJ | - |
| GPY16_RS17815 | 679064..680281 | - | 1218 | WP_102982209.1 | type VI secretion system-associated FHA domain protein TagH | - |
| GPY16_RS17820 | 680598..682766 | + | 2169 | WP_158105777.1 | serine/threonine protein kinase | - |
| GPY16_RS17825 | 682835..683452 | - | 618 | WP_094866600.1 | glutathione S-transferase | - |
| GPY16_RS17830 | 683553..684140 | + | 588 | WP_039546683.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS17835 | 684137..684535 | + | 399 | WP_038968556.1 | DUF296 domain-containing protein | - |
| GPY16_RS17840 | 684539..684763 | - | 225 | WP_038941152.1 | DUF3820 family protein | - |
| GPY16_RS17845 | 684835..685140 | + | 306 | WP_080533744.1 | cysteine-rich CWC family protein | - |
| GPY16_RS17850 | 685160..685504 | - | 345 | WP_039546686.1 | HopJ type III effector protein | - |
| GPY16_RS17855 | 686003..687364 | + | 1362 | WP_158106084.1 | bifunctional diguanylate cyclase/phosphodiesterase | - |
| GPY16_RS17860 | 687464..687796 | - | 333 | WP_011081408.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
| GPY16_RS17865 | 687789..688580 | - | 792 | WP_011081409.1 | phenylalanine 4-monooxygenase | - |
| GPY16_RS17870 | 688807..690783 | + | 1977 | WP_080533743.1 | acetoacetate--CoA ligase | - |
| GPY16_RS17875 | 690896..691489 | - | 594 | WP_039537628.1 | class I SAM-dependent methyltransferase | - |
| GPY16_RS17880 | 691637..692515 | + | 879 | WP_011081412.1 | LysR family transcriptional regulator | - |
| GPY16_RS17885 | 692690..693583 | + | 894 | WP_017422708.1 | cation diffusion facilitator family transporter | - |
| GPY16_RS17890 | 693614..694510 | - | 897 | WP_158105778.1 | aromatic amino acid DMT transporter YddG | - |
| GPY16_RS22480 | 694637..694798 | + | 162 | WP_165386069.1 | hypothetical protein | - |
| GPY16_RS17895 | 694887..695537 | + | 651 | WP_038941157.1 | isoprenoid biosynthesis glyoxalase ElbB | - |
| GPY16_RS17900 | 695558..696538 | - | 981 | WP_103181969.1 | hypothetical protein | - |
| GPY16_RS17905 | 696616..698613 | + | 1998 | WP_158105779.1 | GHKL domain-containing protein | - |
| GPY16_RS17910 | 698705..700246 | - | 1542 | WP_158105780.1 | DUF3369 domain-containing protein | - |
| GPY16_RS17915 | 700342..700662 | - | 321 | WP_039546693.1 | DOPA 4,5-dioxygenase family protein | - |
| GPY16_RS17920 | 700936..701931 | + | 996 | WP_038941162.1 | adenosine deaminase | - |
| GPY16_RS17925 | 702390..703484 | + | 1095 | WP_058666755.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| GPY16_RS17930 | 703477..704460 | + | 984 | WP_017422699.1 | alpha-ketoacid dehydrogenase subunit beta | - |
| GPY16_RS17935 | 704457..705602 | + | 1146 | WP_039537614.1 | 2-oxo acid dehydrogenase subunit E2 | - |
| GPY16_RS17940 | 705785..706750 | - | 966 | WP_199245059.1 | FAD-binding protein | - |
| GPY16_RS17945 | 706782..707558 | - | 777 | WP_158105782.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
| GPY16_RS17950 | 707765..709432 | + | 1668 | WP_158105783.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
| GPY16_RS17955 | 709834..711465 | + | 1632 | WP_045594633.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS17960 | 711513..712739 | + | 1227 | WP_045594632.1 | alanine racemase | - |
| GPY16_RS17965 | 712888..728508 | - | 15621 | WP_158105784.1 | MARTX multifunctional-autoprocessing repeats-in-toxin holotoxin RtxA | - |
| GPY16_RS17970 | 728531..728992 | - | 462 | WP_039537592.1 | RTX toxin-activating lysine-acyltransferase RtxC | - |
| GPY16_RS17975 | 729018..729377 | - | 360 | WP_011988329.1 | hypothetical protein | - |
| GPY16_RS17980 | 729817..731922 | + | 2106 | WP_158105785.1 | RTX toxin T1SS ABC transporter subunit RtxB | - |
| GPY16_RS17985 | 731919..733280 | + | 1362 | WP_017422689.1 | HlyD family type I secretion periplasmic adaptor subunit | - |
| GPY16_RS17990 | 733283..735451 | + | 2169 | WP_039537584.1 | type I secretion system permease/ATPase | - |
| GPY16_RS17995 | 735532..736224 | - | 693 | WP_170861666.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS18000 | 736499..737245 | + | 747 | WP_039450511.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS18005 | 737416..737817 | + | 402 | WP_017422685.1 | MbcA/ParS/Xre antitoxin family protein | - |
| GPY16_RS18010 | 737808..738491 | + | 684 | WP_172665600.1 | RES family NAD+ phosphorylase | - |
| GPY16_RS18015 | 738511..739269 | - | 759 | WP_011081439.1 | SDR family oxidoreductase | - |
| GPY16_RS18020 | 739317..740225 | - | 909 | WP_158105786.1 | 3-hydroxyisobutyrate dehydrogenase | - |
| GPY16_RS18025 | 740341..741471 | - | 1131 | WP_039546720.1 | enoyl-CoA hydratase/isomerase family protein | - |
| GPY16_RS18030 | 741493..742290 | - | 798 | WP_045610655.1 | enoyl-CoA hydratase | - |
| GPY16_RS18035 | 742317..743471 | - | 1155 | WP_038964578.1 | acyl-CoA dehydrogenase family protein | - |
| GPY16_RS18040 | 743509..745002 | - | 1494 | WP_158105787.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| GPY16_RS18045 | 745047..746261 | - | 1215 | WP_158105788.1 | thiolase family protein | - |
| GPY16_RS18050 | 746456..746845 | + | 390 | WP_158105789.1 | MerR family DNA-binding transcriptional regulator | - |
| GPY16_RS18055 | 746911..748080 | + | 1170 | WP_158105790.1 | isovaleryl-CoA dehydrogenase | - |
| GPY16_RS18060 | 748119..749723 | + | 1605 | WP_158105791.1 | methylcrotonoyl-CoA carboxylase | - |
| GPY16_RS18065 | 749750..750559 | + | 810 | WP_158105792.1 | enoyl-CoA hydratase/isomerase family protein | - |
| GPY16_RS18070 | 750556..751473 | + | 918 | WP_158105793.1 | hydroxymethylglutaryl-CoA lyase | - |
| GPY16_RS18075 | 751689..752282 | + | 594 | WP_017422673.1 | alkyl hydroperoxide reductase subunit C | - |
| GPY16_RS18080 | 752419..753987 | + | 1569 | WP_158105794.1 | alkyl hydroperoxide reductase subunit F | - |
| GPY16_RS18085 | 754292..754504 | + | 213 | WP_011081453.1 | cold-shock protein | - |
| GPY16_RS22485 | 755051..755191 | + | 141 | WP_165385799.1 | hypothetical protein | - |
| GPY16_RS18095 | 755286..756254 | - | 969 | WP_039546736.1 | calcium/sodium antiporter | - |
| GPY16_RS18100 | 756668..757252 | + | 585 | WP_045609762.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS18105 | 757340..758371 | + | 1032 | WP_158105795.1 | NADP-dependent oxidoreductase | - |
| GPY16_RS18110 | 758381..758998 | + | 618 | WP_017791008.1 | glutathione S-transferase | - |
| GPY16_RS18115 | 759155..759415 | + | 261 | WP_038941203.1 | DUF3012 domain-containing protein | - |
| GPY16_RS18120 | 759665..760246 | + | 582 | WP_158105796.1 | helix-turn-helix domain-containing protein | - |
| GPY16_RS18125 | 760212..760622 | + | 411 | WP_130346550.1 | hypothetical protein | - |
| GPY16_RS18130 | 761186..762583 | + | 1398 | WP_011152339.1 | hexose-6-phosphate:phosphate antiporter | - |
| GPY16_RS18135 | 762720..763328 | + | 609 | WP_026050808.1 | transcriptional regulator UhpA | - |
| GPY16_RS18140 | 763328..764827 | + | 1500 | WP_158105797.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
| GPY16_RS18145 | 764833..766173 | + | 1341 | WP_017422662.1 | MFS transporter | - |
| GPY16_RS18150 | 766278..767489 | + | 1212 | WP_158105798.1 | mannose-6-phosphate isomerase, class I | - |
| GPY16_RS18160 | 767921..769294 | - | 1374 | WP_103186552.1 | sensor domain-containing diguanylate cyclase | - |
| GPY16_RS18165 | 769607..770770 | + | 1164 | WP_038941209.1 | threonine/serine exporter family protein | - |
| GPY16_RS18170 | 770730..771008 | - | 279 | WP_017422659.1 | ribosome alternative rescue factor ArfA | - |
| GPY16_RS18175 | 771465..771674 | + | 210 | WP_017422658.1 | cold-shock protein | - |
| GPY16_RS18180 | 771749..772288 | + | 540 | WP_017422657.1 | YaeQ family protein | - |
| GPY16_RS18185 | 772281..772820 | + | 540 | WP_039546754.1 | hypothetical protein | - |
| GPY16_RS18190 | 772889..773248 | + | 360 | WP_045628207.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| GPY16_RS18195 | 773345..773947 | - | 603 | WP_097352294.1 | OmpA family protein | - |
| GPY16_RS18200 | 774166..774792 | + | 627 | WP_039537508.1 | thiol:disulfide interchange protein DsbA/DsbL | - |
| GPY16_RS18205 | 774810..775283 | + | 474 | WP_017422652.1 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
| GPY16_RS18210 | 775359..775961 | - | 603 | WP_039546766.1 | beta-phosphoglucomutase family hydrolase | - |
| GPY16_RS18215 | 776294..778066 | + | 1773 | WP_045628213.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS18220 | 778144..781296 | - | 3153 | WP_039546768.1 | multidrug efflux RND transporter permease subunit VmeZ | - |
| GPY16_RS18225 | 781306..782433 | - | 1128 | WP_158105799.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS18230 | 782779..783237 | + | 459 | WP_015728084.1 | cytidine/deoxycytidylate deaminase family protein | - |
| GPY16_RS18235 | 783328..784557 | - | 1230 | WP_038963925.1 | peptidase T | - |
| GPY16_RS18240 | 784782..785669 | - | 888 | WP_158105800.1 | hypothetical protein | - |
| GPY16_RS18245 | 785749..786657 | - | 909 | WP_158105801.1 | aldo/keto reductase family oxidoreductase | - |
| GPY16_RS18250 | 786751..787161 | + | 411 | WP_017422644.1 | hypothetical protein | - |
| GPY16_RS18255 | 787124..787732 | - | 609 | WP_158105802.1 | hypothetical protein | - |
| GPY16_RS18260 | 788173..789576 | + | 1404 | WP_158105803.1 | H(+)/Cl(-) exchange transporter ClcA | - |
| GPY16_RS18265 | 789820..790791 | + | 972 | WP_039537481.1 | TDT family transporter | - |
| GPY16_RS18270 | 790836..792074 | - | 1239 | WP_026130895.1 | divalent metal cation transporter | - |
| GPY16_RS18275 | 792330..792983 | - | 654 | WP_011081489.1 | GTP cyclohydrolase I FolE | - |
| GPY16_RS18280 | 793159..794394 | + | 1236 | WP_158105804.1 | molybdopterin molybdotransferase MoeA | - |
| GPY16_RS18285 | 794404..795198 | + | 795 | WP_158105805.1 | molybdopterin-synthase adenylyltransferase MoeB | - |
| GPY16_RS18290 | 795345..795656 | + | 312 | WP_039560512.1 | hypothetical protein | - |
| GPY16_RS18295 | 795669..796499 | + | 831 | WP_158105806.1 | sulfurtransferase | - |
| GPY16_RS18300 | 796529..798805 | + | 2277 | WP_017791032.1 | EAL domain-containing protein | - |
| GPY16_RS18305 | 798882..800180 | - | 1299 | WP_158105807.1 | glycoside hydrolase family 18 protein | - |
| GPY16_RS18310 | 800317..801309 | - | 993 | WP_015728093.1 | sugar-binding transcriptional regulator | - |
| GPY16_RS18315 | 801773..802723 | + | 951 | WP_015728094.1 | transaldolase | - |
| GPY16_RS18320 | 802805..804796 | + | 1992 | WP_158105808.1 | transketolase | - |
| GPY16_RS18325 | 805062..805670 | + | 609 | WP_170861643.1 | methylamine utilization protein | - |
| GPY16_RS18330 | 805667..808060 | + | 2394 | WP_158105809.1 | bifunctional diguanylate cyclase/phosphodiesterase | - |
| GPY16_RS18335 | 808110..809672 | - | 1563 | WP_158105810.1 | PAS domain-containing protein | - |
| GPY16_RS18340 | 809985..811037 | - | 1053 | WP_017419625.1 | 3-deoxy-7-phosphoheptulonate synthase AroG | - |
| GPY16_RS18345 | 811418..812491 | + | 1074 | WP_017419624.1 | OmpA family protein | - |
| GPY16_RS18350 | 812607..813506 | - | 900 | WP_158105811.1 | heme o synthase | - |
| GPY16_RS18355 | 813499..814524 | - | 1026 | WP_039447301.1 | COX15/CtaA family protein | - |
| GPY16_RS18360 | 814538..815071 | - | 534 | WP_038969018.1 | hypothetical protein | - |
| GPY16_RS18365 | 815052..815879 | - | 828 | WP_199245057.1 | SURF1 family protein | - |
| GPY16_RS22490 | 815830..816054 | + | 225 | WP_015728103.1 | DUF2909 domain-containing protein | - |
| GPY16_RS18375 | 816065..816949 | - | 885 | WP_039447291.1 | cytochrome c oxidase subunit 3 | - |
| GPY16_RS18380 | 816946..817554 | - | 609 | WP_026050220.1 | cytochrome c oxidase assembly protein | - |
| GPY16_RS18385 | 817564..819195 | - | 1632 | WP_045628231.1 | cytochrome c oxidase subunit I | - |
| GPY16_RS18390 | 819192..820310 | - | 1119 | WP_158106085.1 | cytochrome c oxidase subunit II | - |
| GPY16_RS18395 | 820682..822391 | + | 1710 | WP_158105813.1 | phospho-sugar mutase | - |
| GPY16_RS18400 | 822448..822870 | - | 423 | WP_103189171.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS18405 | 823011..823643 | - | 633 | WP_072609544.1 | LysE family translocator | - |
| GPY16_RS18410 | 823874..824704 | + | 831 | WP_103189172.1 | AraC family transcriptional regulator | - |
| GPY16_RS18415 | 824774..825487 | + | 714 | WP_199245060.1 | AzlC family ABC transporter permease | - |
| GPY16_RS18420 | 825484..825798 | + | 315 | WP_017419610.1 | AzlD domain-containing protein | - |
| GPY16_RS18425 | 825820..826434 | - | 615 | WP_158105814.1 | fumarylacetoacetate hydrolase family protein | - |
| GPY16_RS18430 | 826537..826995 | - | 459 | WP_026050216.1 | MarR family transcriptional regulator | - |
| GPY16_RS18435 | 827110..827532 | + | 423 | WP_045609071.1 | organic hydroperoxide resistance protein | - |
| GPY16_RS18440 | 827640..828659 | - | 1020 | WP_039546836.1 | porin | - |
| GPY16_RS18445 | 829126..829617 | + | 492 | WP_038939877.1 | protein disulfide oxidoreductase | - |
| GPY16_RS18450 | 829770..830747 | + | 978 | WP_045628234.1 | porin | - |
| GPY16_RS18455 | 831031..832806 | + | 1776 | WP_017419603.1 | bifunctional diguanylate cyclase/phosphodiesterase | - |
| GPY16_RS18460 | 833111..833989 | + | 879 | WP_011081525.1 | DMT family transporter | - |
| GPY16_RS18465 | 834054..834659 | + | 606 | WP_017419601.1 | glutaredoxin | - |
| GPY16_RS18470 | 835080..835430 | - | 351 | WP_158105815.1 | hypothetical protein | - |
| GPY16_RS18475 | 835489..836682 | - | 1194 | WP_158105816.1 | multidrug effflux MFS transporter | - |
| GPY16_RS18480 | 836790..837677 | + | 888 | WP_017791059.1 | LysR family transcriptional regulator | - |
| GPY16_RS18485 | 837869..839710 | + | 1842 | WP_172665043.1 | GGDEF domain-containing phosphodiesterase | - |
| GPY16_RS18490 | 839831..840193 | - | 363 | WP_102983192.1 | RidA family protein | - |
| GPY16_RS18495 | 840220..841260 | - | 1041 | WP_158105817.1 | lactonase family protein | - |
| GPY16_RS18500 | 841339..843810 | - | 2472 | WP_158105818.1 | family 20 glycosylhydrolase | - |
| GPY16_RS18505 | 843890..845407 | - | 1518 | WP_038939890.1 | sodium:solute symporter family protein | - |
| GPY16_RS18510 | 845597..845989 | - | 393 | WP_011081536.1 | RidA family protein | - |
| GPY16_RS18515 | 846066..847499 | - | 1434 | WP_103181566.1 | D-aminoacylase | - |
| GPY16_RS18520 | 847682..848947 | + | 1266 | WP_130242562.1 | amino acid deaminase | - |
| GPY16_RS18525 | 849044..849907 | + | 864 | WP_158105819.1 | MurR/RpiR family transcriptional regulator | - |
| GPY16_RS18530 | 850153..851103 | + | 951 | WP_039467423.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| GPY16_RS18535 | 851107..852033 | + | 927 | WP_039537375.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS18540 | 852030..853127 | + | 1098 | WP_039546858.1 | ABC transporter permease | - |
| GPY16_RS18545 | 853208..854149 | + | 942 | WP_046030392.1 | Gfo/Idh/MocA family oxidoreductase | - |
| GPY16_RS18550 | 854231..854860 | - | 630 | WP_039546872.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS18555 | 855053..856072 | + | 1020 | WP_045628532.1 | MBL fold metallo-hydrolase | - |
| GPY16_RS18560 | 856221..857123 | + | 903 | WP_046030394.1 | CDF family Co(II)/Ni(II) efflux transporter DmeF | - |
| GPY16_RS18565 | 857123..857539 | + | 417 | WP_011081548.1 | MarR family transcriptional regulator | - |
| GPY16_RS18570 | 857527..857946 | - | 420 | WP_046030395.1 | VOC family protein | - |
| GPY16_RS18575 | 857977..858405 | - | 429 | WP_038969505.1 | VOC family protein | - |
| GPY16_RS18580 | 858648..860189 | + | 1542 | WP_158105820.1 | DEAD/DEAH box helicase | - |
| GPY16_RS18585 | 860254..860661 | - | 408 | WP_046030399.1 | ribosome recycling factor family protein | - |
| GPY16_RS18590 | 860697..861320 | - | 624 | WP_046030400.1 | type B chloramphenicol O-acetyltransferase | - |
| GPY16_RS18595 | 861331..861705 | - | 375 | WP_158105821.1 | hypothetical protein | - |
| GPY16_RS18600 | 861883..862401 | + | 519 | WP_199245058.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS18605 | 862618..863946 | + | 1329 | WP_158105823.1 | sphingomyelin phosphodiesterase | - |
| GPY16_RS18610 | 863943..864926 | + | 984 | WP_045609051.1 | hypothetical protein | - |
| GPY16_RS18615 | 864996..866018 | - | 1023 | WP_038969501.1 | tryptophan--tRNA ligase | - |
| GPY16_RS18620 | 866278..866706 | - | 429 | WP_080533941.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS18625 | 867076..867483 | + | 408 | WP_017419570.1 | nucleoside diphosphate kinase regulator | - |
| GPY16_RS18630 | 867744..868259 | + | 516 | WP_017419569.1 | RNA methyltransferase | - |
| GPY16_RS18635 | 868536..868727 | + | 192 | WP_158105824.1 | hypothetical protein | - |
| GPY16_RS18640 | 868757..869587 | + | 831 | WP_154185896.1 | hypothetical protein | - |
| GPY16_RS18645 | 869608..871023 | + | 1416 | WP_158105825.1 | hypothetical protein | - |
| GPY16_RS18650 | 871079..871969 | - | 891 | WP_158106086.1 | hypothetical protein | - |
| GPY16_RS18655 | 872156..872602 | + | 447 | Protein_721 | site-specific integrase | - |
| GPY16_RS18660 | 873146..874192 | - | 1047 | WP_038939589.1 | GMP reductase | - |
| GPY16_RS18665 | 874695..875246 | + | 552 | WP_017421678.1 | outer membrane beta-barrel protein | - |
| GPY16_RS18670 | 875442..876938 | - | 1497 | WP_158105826.1 | NAD(P)H-hydrate dehydratase | - |
| GPY16_RS18675 | 877041..877481 | - | 441 | WP_011081647.1 | PAS domain-containing protein | - |
| GPY16_RS18680 | 877481..878485 | - | 1005 | WP_017421676.1 | response regulator | - |
| GPY16_RS18685 | 878768..879013 | - | 246 | WP_011081649.1 | hypothetical protein | - |
| GPY16_RS18690 | 879159..879791 | - | 633 | WP_017421675.1 | response regulator | - |
| GPY16_RS18695 | 879788..881503 | - | 1716 | WP_038969494.1 | nitrate/nitrite two-component system sensor histidine kinase NarQ | - |
| GPY16_RS18700 | 881754..882236 | + | 483 | WP_103196315.1 | ferredoxin-type protein NapF | - |
| GPY16_RS18705 | 882257..882562 | + | 306 | WP_011152448.1 | chaperone NapD | - |
| GPY16_RS18710 | 882559..885048 | + | 2490 | WP_017421672.1 | periplasmic nitrate reductase subunit alpha | - |
| GPY16_RS18715 | 885127..885600 | + | 474 | WP_026050682.1 | nitrate reductase cytochrome c-type subunit | - |
| GPY16_RS18720 | 885631..886206 | + | 576 | WP_011081656.1 | cytochrome c3 family protein | - |
| GPY16_RS18725 | 886218..886352 | + | 135 | WP_158105827.1 | TIGR02808 family protein | - |
| GPY16_RS18730 | 886489..887550 | - | 1062 | WP_158105828.1 | YjhT family mutarotase | - |
| GPY16_RS18735 | 887562..888716 | - | 1155 | WP_103181581.1 | N-acetylneuraminate epimerase | - |
| GPY16_RS18740 | 888898..889734 | - | 837 | WP_039467364.1 | MurR/RpiR family transcriptional regulator | - |
| GPY16_RS18745 | 889842..890738 | - | 897 | WP_158106087.1 | N-acetylneuraminate lyase | - |
| GPY16_RS18750 | 890776..892059 | - | 1284 | WP_039467360.1 | sialic acid TRAP transporter large permease SiaM | - |
| GPY16_RS18755 | 892069..892587 | - | 519 | WP_180981872.1 | TRAP transporter small permease | - |
| GPY16_RS18760 | 892638..893603 | - | 966 | WP_026130915.1 | sialic acid TRAP transporter substrate-binding protein SiaP | - |
| GPY16_RS18765 | 893839..894555 | + | 717 | WP_039537328.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| GPY16_RS18770 | 894536..895417 | + | 882 | WP_045593212.1 | N-acetylmannosamine kinase | - |
| GPY16_RS18775 | 895414..896550 | + | 1137 | WP_045593213.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| GPY16_RS18780 | 896683..898356 | - | 1674 | WP_158105829.1 | SgrR family transcriptional regulator | - |
| GPY16_RS18785 | 898799..900571 | - | 1773 | WP_017421668.1 | class I poly(R)-hydroxyalkanoic acid synthase | - |
| GPY16_RS18790 | 900632..900979 | - | 348 | WP_011081668.1 | phasin family protein | - |
| GPY16_RS18795 | 901020..902228 | - | 1209 | WP_158105830.1 | acetyl-CoA C-acetyltransferase | - |
| GPY16_RS18800 | 902241..902981 | - | 741 | WP_015728153.1 | SDR family oxidoreductase | - |
| GPY16_RS18805 | 903538..904440 | - | 903 | WP_017421667.1 | protein translocase subunit SecF | - |
| GPY16_RS18810 | 904443..906287 | - | 1845 | WP_158105831.1 | protein translocase subunit SecD | - |
| GPY16_RS18815 | 906357..906833 | - | 477 | WP_039537312.1 | hypothetical protein | - |
| GPY16_RS18820 | 906969..907628 | - | 660 | WP_038963126.1 | SH3 domain-containing protein | - |
| GPY16_RS18825 | 907784..908347 | + | 564 | WP_158105832.1 | hypothetical protein | - |
| GPY16_RS18830 | 908829..909290 | - | 462 | WP_011081676.1 | Lrp/AsnC family transcriptional regulator | - |
| GPY16_RS18835 | 909438..910412 | + | 975 | WP_039546927.1 | DMT family transporter | - |
| GPY16_RS18840 | 910568..911227 | + | 660 | WP_017421659.1 | flagellar brake protein | - |
| GPY16_RS18845 | 911224..913797 | - | 2574 | WP_158105833.1 | response regulator | - |
| GPY16_RS18850 | 913794..914894 | - | 1101 | WP_017421657.1 | autoinducer 2-binding periplasmic protein LuxP | - |
| GPY16_RS18855 | 915082..916251 | - | 1170 | WP_026050679.1 | conjugal transfer protein TraF | - |
| GPY16_RS18860 | 916328..916624 | - | 297 | WP_017421655.1 | GIY-YIG nuclease family protein | - |
| GPY16_RS18865 | 916624..917286 | - | 663 | WP_039447168.1 | YceH family protein | - |
| GPY16_RS18870 | 917352..917561 | - | 210 | WP_017421653.1 | hypothetical protein | - |
| GPY16_RS18875 | 917831..918145 | + | 315 | WP_011081685.1 | DUF496 family protein | - |
| GPY16_RS18880 | 918315..919643 | + | 1329 | WP_103196322.1 | MATE family efflux transporter | - |
| GPY16_RS18885 | 919695..922340 | - | 2646 | WP_158105834.1 | response regulator | - |
| GPY16_RS18890 | 922450..922908 | + | 459 | WP_011081688.1 | hypothetical protein | - |
| GPY16_RS18895 | 922909..923961 | + | 1053 | WP_158105835.1 | sulfate ABC transporter permease | - |
| GPY16_RS18900 | 924296..925732 | + | 1437 | WP_158105836.1 | glyceraldehyde-3-phosphate dehydrogenase | - |
| GPY16_RS18905 | 926068..926295 | + | 228 | WP_011081691.1 | hypothetical protein | - |
| GPY16_RS18910 | 926292..927164 | - | 873 | WP_086017755.1 | LysR family transcriptional regulator | - |
| GPY16_RS18915 | 927269..928525 | + | 1257 | WP_039546941.1 | adenylosuccinate synthase | - |
| GPY16_RS18920 | 928717..929190 | + | 474 | WP_017421631.1 | peroxiredoxin | - |
| GPY16_RS18925 | 929274..929888 | - | 615 | WP_026050675.1 | LysE family translocator | - |
| GPY16_RS18930 | 929946..930887 | - | 942 | WP_158105837.1 | LysR family transcriptional regulator | - |
| GPY16_RS18935 | 930880..931338 | - | 459 | WP_039447149.1 | Lrp/AsnC family transcriptional regulator | - |
| GPY16_RS18940 | 931594..932847 | + | 1254 | WP_015728177.1 | L-methionine/branched-chain amino acid transporter | - |
| GPY16_RS18945 | 932861..933622 | - | 762 | WP_017421626.1 | class II glutamine amidotransferase | - |
| GPY16_RS18950 | 933635..935092 | - | 1458 | WP_199245022.1 | PLP-dependent aminotransferase family protein | - |
| GPY16_RS18955 | 935215..935880 | + | 666 | WP_039537283.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| GPY16_RS18960 | 935972..937372 | - | 1401 | WP_039546954.1 | two-component sensor histidine kinase | - |
| GPY16_RS18965 | 937372..938076 | - | 705 | WP_039447136.1 | response regulator transcription factor | - |
| GPY16_RS18970 | 938461..939165 | + | 705 | WP_039546957.1 | hypothetical protein | - |
| GPY16_RS18975 | 939218..940228 | - | 1011 | WP_158105839.1 | AraC family transcriptional regulator | - |
| GPY16_RS18980 | 940335..940664 | + | 330 | WP_017421622.1 | hypothetical protein | - |
| GPY16_RS18985 | 940661..941884 | + | 1224 | WP_158105840.1 | biotin/lipoyl-binding protein | - |
| GPY16_RS18990 | 942025..943371 | + | 1347 | WP_039537274.1 | magnesium transporter | - |
| GPY16_RS18995 | 943940..944842 | + | 903 | WP_199245023.1 | AraC family transcriptional regulator | - |
| GPY16_RS19000 | 945130..946368 | + | 1239 | WP_026050672.1 | cytosine permease | - |
| GPY16_RS19005 | 946378..947655 | + | 1278 | WP_072609504.1 | cytosine deaminase | - |
| GPY16_RS19010 | 947977..950337 | - | 2361 | WP_039537266.1 | ATP-binding protein | - |
| GPY16_RS19015 | 950606..951106 | + | 501 | WP_017421616.1 | hypothetical protein | - |
| GPY16_RS19020 | 951121..952749 | + | 1629 | WP_017421615.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS19025 | 952931..954967 | - | 2037 | WP_158105842.1 | prolyl oligopeptidase family serine peptidase | - |
| GPY16_RS19030 | 955202..956101 | - | 900 | WP_017421612.1 | LysR family transcriptional regulator | - |
| GPY16_RS19035 | 956314..958008 | + | 1695 | WP_158105843.1 | L-lactate permease | - |
| GPY16_RS19040 | 958154..958909 | + | 756 | WP_045610523.1 | (Fe-S)-binding protein | - |
| GPY16_RS19045 | 958909..960339 | + | 1431 | WP_039560935.1 | iron-sulfur cluster-binding protein | - |
| GPY16_RS19050 | 960336..960995 | + | 660 | WP_039447122.1 | lactate utilization protein C | - |
| GPY16_RS19055 | 961307..964147 | + | 2841 | WP_158105844.1 | FAD-binding oxidoreductase | - |
| GPY16_RS19060 | 964273..965028 | + | 756 | WP_038968158.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS19065 | 965154..967217 | + | 2064 | WP_158105845.1 | VIT and VWA domain-containing protein | - |
| GPY16_RS19070 | 967400..969271 | + | 1872 | WP_158105846.1 | MFS transporter | - |
| GPY16_RS19075 | 969366..969998 | + | 633 | WP_026050669.1 | cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase | - |
| GPY16_RS19080 | 970302..970883 | + | 582 | WP_017421603.1 | porin family protein | - |
| GPY16_RS19100 | 971443..972153 | - | 711 | WP_045590411.1 | MBL fold metallo-hydrolase | - |
| GPY16_RS19105 | 972317..975304 | - | 2988 | WP_158105847.1 | alkaline phosphatase family protein | - |
| GPY16_RS19110 | 975367..977415 | - | 2049 | WP_039537238.1 | PTS sugar transporter subunit IIC/EAL domain-containing protein | - |
| GPY16_RS19115 | 977751..978596 | - | 846 | WP_017421599.1 | mechanosensitive ion channel family protein | - |
| GPY16_RS19120 | 978762..979229 | - | 468 | WP_026050666.1 | DM13 domain-containing protein | - |
| GPY16_RS19125 | 979513..980019 | - | 507 | WP_017421598.1 | copper resistance protein NlpE | - |
| GPY16_RS19130 | 980302..981030 | + | 729 | WP_026050665.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| GPY16_RS19135 | 981154..981885 | + | 732 | WP_038963762.1 | arginine ABC transporter substrate-binding protein | - |
| GPY16_RS19140 | 981887..982576 | + | 690 | WP_039537225.1 | arginine ABC transporter permease ArtQ | - |
| GPY16_RS19145 | 982573..983241 | + | 669 | WP_015728208.1 | arginine ABC transporter permease ArtM | - |
| GPY16_RS19150 | 983425..983985 | + | 561 | WP_158105848.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| GPY16_RS19155 | 984044..987664 | - | 3621 | WP_158105849.1 | hypothetical protein | - |
| GPY16_RS19160 | 988199..990376 | - | 2178 | WP_158105850.1 | EAL domain-containing protein | - |
| GPY16_RS19165 | 990717..991805 | + | 1089 | WP_046029445.1 | SGNH/GDSL hydrolase family protein | - |
| GPY16_RS19170 | 991890..992657 | - | 768 | WP_038968149.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS19175 | 993051..994586 | + | 1536 | WP_103163267.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS19180 | 994660..995388 | + | 729 | WP_017421587.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS19185 | 995467..997509 | - | 2043 | WP_039537207.1 | PhoX family phosphatase | - |
| GPY16_RS19190 | 997791..998129 | + | 339 | WP_011081746.1 | YggL family protein | - |
| GPY16_RS19195 | 998180..998875 | - | 696 | WP_158105851.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
| GPY16_RS19200 | 998880..1001918 | - | 3039 | WP_158105852.1 | peptide synthetase | - |
| GPY16_RS19205 | 1001988..1006445 | - | 4458 | WP_158105853.1 | amino acid adenylation domain-containing protein | - |
| GPY16_RS19210 | 1006770..1007840 | + | 1071 | WP_158105854.1 | 3-deoxy-7-phosphoheptulonate synthase | - |
| GPY16_RS19215 | 1008104..1008892 | - | 789 | WP_158105855.1 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase | - |
| GPY16_RS19220 | 1009265..1010446 | + | 1182 | WP_158105856.1 | isochorismate synthase | - |
| GPY16_RS19225 | 1010456..1012096 | + | 1641 | WP_158105857.1 | (2,3-dihydroxybenzoyl)adenylate synthase | - |
| GPY16_RS19230 | 1012211..1013026 | - | 816 | WP_039448178.1 | siderophore-interacting protein | - |
| GPY16_RS19235 | 1013089..1013976 | - | 888 | WP_158105858.1 | isochorismatase family protein | - |
| GPY16_RS19240 | 1014077..1014397 | - | 321 | WP_157401382.1 | isochorismate lyase | - |
| GPY16_RS19245 | 1014635..1016263 | - | 1629 | WP_158105859.1 | AMP-binding protein | - |
| GPY16_RS19250 | 1016489..1016731 | + | 243 | WP_017791171.1 | acyl carrier protein | - |
| GPY16_RS19255 | 1016787..1017695 | + | 909 | WP_038940398.1 | siderophore ABC transporter substrate-binding protein | - |
| GPY16_RS19260 | 1017781..1019838 | - | 2058 | WP_158105860.1 | TonB-dependent receptor | - |
| GPY16_RS19265 | 1020178..1021449 | - | 1272 | WP_158106088.1 | short-chain isoprenyl diphosphate synthase | - |
| GPY16_RS19270 | 1023025..1023930 | + | 906 | WP_011081763.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
| GPY16_RS19275 | 1023994..1024422 | + | 429 | WP_026050663.1 | RimK/LysX family protein | - |
| GPY16_RS19280 | 1024469..1025239 | - | 771 | WP_158105861.1 | MBL fold metallo-hydrolase | - |
| GPY16_RS19285 | 1025531..1025833 | + | 303 | WP_080721695.1 | hypothetical protein | - |
| GPY16_RS19290 | 1025923..1027305 | + | 1383 | WP_158105862.1 | TolC family protein | - |
| GPY16_RS19295 | 1027310..1029019 | + | 1710 | WP_045593304.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS19300 | 1029016..1032144 | + | 3129 | WP_158105863.1 | efflux RND transporter permease subunit | - |
| GPY16_RS19305 | 1032239..1032805 | + | 567 | WP_193785274.1 | copper-binding protein | - |
| GPY16_RS19310 | 1033091..1033162 | + | 72 | WP_123773448.1 | tryptophanase leader peptide | - |
| GPY16_RS19315 | 1033413..1034834 | + | 1422 | WP_045590127.1 | tryptophanase | - |
| GPY16_RS19320 | 1034932..1036146 | + | 1215 | WP_158105864.1 | aromatic amino acid transporter | - |
| GPY16_RS19325 | 1036184..1037752 | - | 1569 | WP_158105865.1 | ATP-binding cassette domain-containing protein | - |
| GPY16_RS19330 | 1038145..1038843 | + | 699 | WP_011152563.1 | hypothetical protein | - |
| GPY16_RS19335 | 1039024..1040355 | - | 1332 | WP_199245024.1 | ferric reductase-like transmembrane domain-containing protein | - |
| GPY16_RS19340 | 1040455..1041486 | - | 1032 | WP_038963781.1 | LacI family DNA-binding transcriptional regulator | - |
| GPY16_RS19345 | 1041732..1042175 | + | 444 | WP_011081777.1 | PTS sugar transporter subunit IIA | - |
| GPY16_RS19350 | 1042228..1042515 | + | 288 | WP_094866704.1 | PTS sugar transporter subunit IIB | - |
| GPY16_RS19355 | 1042525..1043781 | + | 1257 | WP_158105867.1 | PTS ascorbate transporter subunit IIC | - |
| GPY16_RS19360 | 1043857..1044363 | - | 507 | WP_017421556.1 | peptide deformylase | - |
| GPY16_RS19365 | 1044537..1048274 | - | 3738 | WP_102983029.1 | peptidase M66 | - |
| GPY16_RS19370 | 1048772..1050085 | + | 1314 | WP_039537155.1 | hemolysin family protein | - |
| GPY16_RS19375 | 1050217..1051737 | - | 1521 | WP_017421553.1 | aldehyde dehydrogenase | - |
| GPY16_RS19380 | 1051977..1053746 | + | 1770 | WP_158105868.1 | sigma-54-dependent Fis family transcriptional regulator | - |
| GPY16_RS19385 | 1053809..1055866 | - | 2058 | WP_158105869.1 | sensor domain-containing diguanylate cyclase | - |
| GPY16_RS19390 | 1055863..1056819 | - | 957 | WP_158105870.1 | substrate-binding domain-containing protein | - |
| GPY16_RS19395 | 1057205..1057852 | - | 648 | WP_170937752.1 | glutathione S-transferase family protein | - |
| GPY16_RS19400 | 1057968..1058819 | + | 852 | WP_026050655.1 | LysR family transcriptional regulator | - |
| GPY16_RS19405 | 1058995..1059801 | + | 807 | WP_170937753.1 | PhzF family phenazine biosynthesis isomerase | - |
| GPY16_RS19410 | 1059938..1060762 | + | 825 | WP_158105871.1 | LuxR family transcriptional regulator | - |
| GPY16_RS19415 | 1060865..1062133 | + | 1269 | WP_038940425.1 | tyrosine--tRNA ligase | - |
| GPY16_RS19420 | 1062192..1063232 | - | 1041 | WP_199245025.1 | oxidoreductase | - |
| GPY16_RS19425 | 1063352..1064608 | - | 1257 | WP_158105873.1 | outer membrane protein transport protein | - |
| GPY16_RS19430 | 1064832..1065656 | + | 825 | WP_158105874.1 | LysR family transcriptional regulator | - |
| GPY16_RS19435 | 1065818..1066849 | - | 1032 | WP_158105875.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS19440 | 1066846..1067358 | - | 513 | WP_017421540.1 | hypothetical protein | - |
| GPY16_RS19445 | 1067535..1069559 | - | 2025 | WP_158105876.1 | MBL fold metallo-hydrolase | - |
| GPY16_RS19450 | 1069711..1070202 | - | 492 | WP_017421538.1 | tetratricopeptide repeat protein | - |
| GPY16_RS19455 | 1070376..1071275 | + | 900 | WP_158105877.1 | LysR family transcriptional regulator | - |
| GPY16_RS19460 | 1071305..1072447 | - | 1143 | WP_199245061.1 | BamA/TamA family outer membrane protein | - |
| GPY16_RS19465 | 1072628..1073530 | - | 903 | WP_039537125.1 | LysR family transcriptional regulator | - |
| GPY16_RS19470 | 1073628..1074449 | - | 822 | WP_158105878.1 | pyridoxal kinase | - |
| GPY16_RS19475 | 1074602..1075216 | - | 615 | WP_130360656.1 | DUF3299 domain-containing protein | - |
| GPY16_RS19480 | 1075346..1076869 | - | 1524 | WP_045613323.1 | M20 family peptidase | - |
| GPY16_RS19485 | 1077183..1077395 | + | 213 | WP_158105879.1 | DUF1656 domain-containing protein | - |
| GPY16_RS19490 | 1077407..1078273 | + | 867 | WP_039537111.1 | HlyD family secretion protein | - |
| GPY16_RS19495 | 1078282..1079658 | + | 1377 | WP_158105880.1 | FUSC family protein | - |
| GPY16_RS19500 | 1080041..1080799 | + | 759 | WP_103163241.1 | hypothetical protein | - |
| GPY16_RS19505 | 1081252..1082892 | + | 1641 | WP_045610169.1 | hypothetical protein | - |
| GPY16_RS19510 | 1082934..1084574 | - | 1641 | WP_158105881.1 | phosphoethanolamine--lipid A transferase | - |
| GPY16_RS19515 | 1084638..1085138 | - | 501 | WP_158105882.1 | cytochrome b/b6 domain-containing protein | - |
| GPY16_RS19520 | 1085131..1085412 | - | 282 | WP_017421534.1 | PepSY domain-containing protein | - |
| GPY16_RS19530 | 1085767..1086552 | + | 786 | WP_158105883.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS19535 | 1086670..1087728 | - | 1059 | WP_039546439.1 | DUF1254 domain-containing protein | - |
| GPY16_RS19540 | 1087877..1088818 | + | 942 | WP_045610168.1 | LysR family transcriptional regulator | - |
| GPY16_RS19545 | 1088815..1089735 | + | 921 | WP_039537079.1 | LysR family transcriptional regulator | - |
| GPY16_RS19550 | 1089814..1090890 | - | 1077 | WP_103196363.1 | DUF1254 domain-containing protein | - |
| GPY16_RS19555 | 1091129..1091512 | - | 384 | WP_026050652.1 | hypothetical protein | - |
| GPY16_RS19560 | 1091687..1092811 | - | 1125 | WP_039546292.1 | M20 family metallopeptidase | - |
| GPY16_RS19565 | 1092821..1093288 | - | 468 | WP_011081810.1 | YjiG family protein | - |
| GPY16_RS19570 | 1093285..1094034 | - | 750 | WP_011081811.1 | membrane protein | - |
| GPY16_RS19575 | 1094443..1094832 | + | 390 | WP_158105884.1 | DUF302 domain-containing protein | - |
| GPY16_RS19580 | 1094863..1096926 | - | 2064 | WP_158105885.1 | alpha-amylase | - |
| GPY16_RS19585 | 1097194..1098360 | - | 1167 | WP_045628349.1 | oligogalacturonate lyase family protein | - |
| GPY16_RS19590 | 1098424..1100196 | - | 1773 | WP_039546301.1 | Na+:solute symporter | - |
| GPY16_RS19595 | 1100484..1102715 | - | 2232 | WP_045589724.1 | hypothetical protein | - |
| GPY16_RS19600 | 1102731..1103459 | - | 729 | WP_158105886.1 | porin | - |
| GPY16_RS19605 | 1103588..1105318 | + | 1731 | WP_158105887.1 | transporter | - |
| GPY16_RS19610 | 1105478..1107178 | + | 1701 | WP_052687764.1 | exopolygalacturonate lyase | - |
| GPY16_RS19615 | 1107192..1107659 | + | 468 | WP_045628548.1 | discoidin domain-containing protein | - |
| GPY16_RS19620 | 1107888..1108511 | - | 624 | WP_038963358.1 | bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase | - |
| GPY16_RS19625 | 1108524..1109453 | - | 930 | WP_158105888.1 | sugar kinase | - |
| GPY16_RS19630 | 1109667..1110545 | + | 879 | WP_158105889.1 | DMT family transporter | - |
| GPY16_RS19635 | 1110794..1112259 | + | 1466 | Protein_913 | hypothetical protein | - |
| GPY16_RS19640 | 1112674..1114077 | + | 1404 | WP_094866727.1 | HD-GYP domain-containing protein | - |
| GPY16_RS19645 | 1114326..1114961 | - | 636 | WP_011081821.1 | RpiB/LacA/LacB family sugar-phosphate isomerase | - |
| GPY16_RS19650 | 1115002..1115322 | - | 321 | WP_017791213.1 | cupin domain-containing protein | - |
| GPY16_RS19655 | 1115334..1115855 | - | 522 | WP_039448050.1 | YgjV family protein | - |
| GPY16_RS19660 | 1115871..1116632 | - | 762 | WP_011081824.1 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD | - |
| GPY16_RS19665 | 1116894..1117676 | + | 783 | WP_026130943.1 | DNA-binding transcriptional regulator KdgR | - |
| GPY16_RS19670 | 1117757..1119622 | + | 1866 | WP_158105890.1 | CBS domain-containing protein | - |
| GPY16_RS19675 | 1119627..1120343 | + | 717 | WP_080533578.1 | DNA polymerase III subunit epsilon | - |
| GPY16_RS19680 | 1120982..1122436 | + | 1455 | WP_158105891.1 | DUF3360 family protein | - |
| GPY16_RS19685 | 1122604..1122999 | + | 396 | WP_045593391.1 | ACT domain-containing protein | - |
| GPY16_RS19690 | 1123084..1124616 | + | 1533 | WP_045590096.1 | bifunctional GNAT family N-acetyltransferase/carbon-nitrogen hydrolase family protein | - |
| GPY16_RS19695 | 1124722..1125318 | + | 597 | WP_039546336.1 | mechanosensitive ion channel family protein | - |
| GPY16_RS19700 | 1125413..1127632 | - | 2220 | WP_158105892.1 | esterase-like activity of phytase family protein | - |
| GPY16_RS19705 | 1128032..1129645 | - | 1614 | WP_158105893.1 | mechanosensitive ion channel family protein | - |
| GPY16_RS19710 | 1130165..1130434 | - | 270 | WP_039546346.1 | hypothetical protein | - |
| GPY16_RS19715 | 1130779..1133916 | - | 3138 | WP_039537000.1 | efflux RND transporter permease subunit | - |
| GPY16_RS19720 | 1133928..1135082 | - | 1155 | WP_199245026.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS19725 | 1135487..1136011 | + | 525 | WP_102983064.1 | molybdopterin-dependent oxidoreductase | - |
| GPY16_RS19730 | 1136020..1138170 | + | 2151 | WP_158105894.1 | response regulator | - |
| GPY16_RS19735 | 1138268..1138669 | + | 402 | WP_158105895.1 | NUDIX domain-containing protein | - |
| GPY16_RS19740 | 1138858..1139397 | + | 540 | WP_017791228.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| GPY16_RS19745 | 1139403..1140209 | + | 807 | WP_158105896.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS19750 | 1140296..1141846 | + | 1551 | WP_199245027.1 | cryptochrome/photolyase family protein | - |
| GPY16_RS19755 | 1141841..1142308 | - | 468 | WP_017791231.1 | redox-sensitive transcriptional activator SoxR | - |
| GPY16_RS19760 | 1142419..1143642 | + | 1224 | WP_038963982.1 | MFS transporter | - |
| GPY16_RS19765 | 1143735..1145177 | - | 1443 | WP_158105898.1 | glucose-specific PTS transporter subunit IIBC | - |
| GPY16_RS19770 | 1145412..1146119 | + | 708 | WP_039538760.1 | response regulator transcription factor | - |
| GPY16_RS19775 | 1146109..1147545 | + | 1437 | WP_158105899.1 | HAMP domain-containing protein | - |
| GPY16_RS19780 | 1147542..1148768 | + | 1227 | WP_046029531.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS19785 | 1149089..1150252 | + | 1164 | WP_017421484.1 | substrate-binding protein | - |
| GPY16_RS19790 | 1150249..1152071 | + | 1823 | Protein_944 | diguanylate cyclase | - |
| GPY16_RS19795 | 1152055..1152510 | + | 456 | WP_015728326.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS19800 | 1152820..1154838 | + | 2019 | WP_039536974.1 | elongation factor G | - |
| GPY16_RS19805 | 1155008..1155205 | - | 198 | WP_011081850.1 | (Na+)-NQR maturation NqrM | - |
| GPY16_RS19810 | 1155207..1155659 | - | 453 | WP_017421480.1 | NifB/NifX family molybdenum-iron cluster-binding protein | - |
| GPY16_RS19815 | 1155656..1155958 | - | 303 | WP_026050535.1 | DUF134 domain-containing protein | - |
| GPY16_RS19820 | 1156096..1156290 | - | 195 | WP_017421478.1 | hypothetical protein | - |
| GPY16_RS19825 | 1156502..1157488 | - | 987 | WP_158105900.1 | cytochrome-c peroxidase | - |
| GPY16_RS19830 | 1157769..1158116 | - | 348 | WP_199245028.1 | GlpM family protein | - |
| GPY16_RS19835 | 1158246..1158566 | - | 321 | WP_039536966.1 | hypothetical protein | - |
| GPY16_RS19840 | 1158847..1159626 | - | 780 | WP_158105902.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS19845 | 1159722..1160879 | + | 1158 | WP_158105903.1 | multidrug effflux MFS transporter | - |
| GPY16_RS19850 | 1161084..1162136 | + | 1053 | WP_158105904.1 | acyltransferase | - |
| GPY16_RS19855 | 1162288..1163184 | + | 897 | WP_045589730.1 | DMT family transporter | - |
| GPY16_RS19860 | 1163274..1163804 | + | 531 | WP_017421471.1 | DUF2799 domain-containing protein | - |
| GPY16_RS19865 | 1163962..1164609 | + | 648 | WP_158105905.1 | DUF2057 domain-containing protein | - |
| GPY16_RS19870 | 1164826..1165689 | + | 864 | WP_017421470.1 | DMT family transporter | - |
| GPY16_RS19875 | 1165667..1166446 | - | 780 | WP_038940476.1 | ferredoxin--NADP reductase | - |
| GPY16_RS19880 | 1166641..1167075 | + | 435 | WP_017421468.1 | acyl-CoA thioesterase | - |
| GPY16_RS19885 | 1167331..1168278 | + | 948 | WP_038963972.1 | LysR family transcriptional regulator | - |
| GPY16_RS19890 | 1168261..1168551 | - | 291 | WP_026050531.1 | antibiotic biosynthesis monooxygenase | - |
| GPY16_RS19895 | 1168568..1169221 | - | 654 | WP_017421465.1 | oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB | - |
| GPY16_RS19900 | 1169486..1170787 | + | 1302 | WP_158105906.1 | alpha/beta fold hydrolase | - |
| GPY16_RS19905 | 1170898..1171422 | - | 525 | WP_038940480.1 | hypothetical protein | - |
| GPY16_RS19910 | 1171758..1172954 | + | 1197 | WP_026050530.1 | DEAD/DEAH box helicase | - |
| GPY16_RS19915 | 1173001..1173210 | - | 210 | WP_011152674.1 | hypothetical protein | - |
| GPY16_RS19920 | 1173285..1174121 | + | 837 | WP_017421462.1 | alpha/beta hydrolase | - |
| GPY16_RS19925 | 1174221..1175105 | - | 885 | WP_038940481.1 | hypothetical protein | - |
| GPY16_RS19930 | 1175658..1176560 | - | 903 | WP_017421460.1 | transglutaminase-like domain-containing protein | - |
| GPY16_RS19935 | 1176699..1177235 | + | 537 | WP_158105907.1 | DUF924 domain-containing protein | - |
| GPY16_RS19940 | 1177318..1179147 | - | 1830 | WP_158105908.1 | M4 family metallopeptidase | - |
| GPY16_RS19945 | 1179496..1180482 | + | 987 | WP_158105909.1 | D-2-hydroxyacid dehydrogenase family protein | - |
| GPY16_RS19950 | 1180510..1180815 | + | 306 | WP_094866748.1 | Rho-binding antiterminator | - |
| GPY16_RS19955 | 1181042..1181698 | + | 657 | WP_038940486.1 | Qnr family pentapeptide repeat protein | - |
| GPY16_RS19960 | 1181712..1182044 | + | 333 | WP_017421454.1 | cupin domain-containing protein | - |
| GPY16_RS19965 | 1182140..1183876 | - | 1737 | WP_094866749.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS19970 | 1183997..1187992 | - | 3996 | WP_158105910.1 | response regulator | - |
| GPY16_RS19975 | 1188106..1189200 | + | 1095 | WP_039536923.1 | two-component system response regulator | - |
| GPY16_RS19980 | 1189386..1189733 | + | 348 | WP_017421450.1 | DUF3316 domain-containing protein | - |
| GPY16_RS19985 | 1189959..1191161 | - | 1203 | WP_046029324.1 | L-2-hydroxyglutarate oxidase | - |
| GPY16_RS19990 | 1191227..1193347 | - | 2121 | WP_038969134.1 | TRAP transporter permease | - |
| GPY16_RS19995 | 1193421..1194431 | - | 1011 | WP_011081891.1 | TAXI family TRAP transporter solute-binding subunit | - |
| GPY16_RS20000 | 1194793..1196169 | - | 1377 | WP_158105911.1 | sigma-54 dependent transcriptional regulator | - |
| GPY16_RS20005 | 1196308..1198368 | + | 2061 | WP_045589742.1 | sensor histidine kinase | - |
| GPY16_RS20010 | 1198445..1198909 | - | 465 | WP_045610140.1 | hypothetical protein | - |
| GPY16_RS20015 | 1198923..1200890 | - | 1968 | WP_045610138.1 | MBL fold metallo-hydrolase | - |
| GPY16_RS20020 | 1201130..1201510 | + | 381 | WP_038969138.1 | DUF3316 domain-containing protein | - |
| GPY16_RS20025 | 1201582..1202277 | + | 696 | WP_158105912.1 | heavy metal response regulator transcription factor | - |
| GPY16_RS20030 | 1202228..1203619 | + | 1392 | WP_039536902.1 | heavy metal sensor histidine kinase | - |
| GPY16_RS20035 | 1203613..1204473 | - | 861 | WP_017421441.1 | LysR family transcriptional regulator | - |
| GPY16_RS20040 | 1204574..1205638 | + | 1065 | WP_158105913.1 | HlyD family secretion protein | - |
| GPY16_RS20045 | 1205647..1206654 | + | 1008 | WP_017421440.1 | DUF2955 domain-containing protein | - |
| GPY16_RS20050 | 1206817..1207845 | - | 1029 | WP_158105914.1 | methionine synthase | - |
| GPY16_RS20055 | 1207876..1208850 | - | 975 | WP_158105915.1 | DUF1852 domain-containing protein | - |
| GPY16_RS20060 | 1209669..1210283 | + | 615 | WP_045589748.1 | outer membrane beta-barrel protein | - |
| GPY16_RS20065 | 1210554..1211555 | - | 1002 | WP_158105916.1 | GGDEF domain-containing protein | - |
| GPY16_RS20070 | 1211638..1212687 | + | 1050 | WP_199245029.1 | linear amide C-N hydrolase | - |
| GPY16_RS20075 | 1213173..1213799 | - | 627 | WP_039536885.1 | LysE family translocator | - |
| GPY16_RS20080 | 1214019..1214704 | - | 686 | Protein_1002 | transposase | - |
| GPY16_RS20085 | 1215061..1216296 | - | 1236 | Protein_1003 | MFS transporter | - |
| GPY16_RS20090 | 1216683..1217297 | + | 615 | WP_158105917.1 | 3'-5' exonuclease | - |
| GPY16_RS20095 | 1217337..1218029 | - | 693 | WP_058666317.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS20100 | 1218052..1219335 | - | 1284 | WP_158105918.1 | ABC transporter permease | - |
| GPY16_RS20105 | 1219338..1220552 | - | 1215 | WP_039547639.1 | ABC transporter permease | - |
| GPY16_RS20110 | 1220549..1221820 | - | 1272 | WP_046029350.1 | TolC family protein | - |
| GPY16_RS20115 | 1221813..1222949 | - | 1137 | WP_158105919.1 | efflux RND transporter periplasmic adaptor subunit | - |
| GPY16_RS20120 | 1223261..1223638 | + | 378 | WP_038940506.1 | hypothetical protein | - |
| GPY16_RS20125 | 1223843..1224577 | + | 735 | WP_158105920.1 | siderophore ferric iron reductase | - |
| GPY16_RS20130 | 1224718..1225485 | + | 768 | WP_158105921.1 | ATP-binding cassette domain-containing protein | - |
| GPY16_RS20135 | 1225503..1226399 | + | 897 | WP_158105922.1 | iron-siderophore ABC transporter substrate-binding protein | - |
| GPY16_RS20140 | 1226396..1228393 | + | 1998 | WP_158105923.1 | Fe(3+)-hydroxamate ABC transporter permease FhuB | - |
| GPY16_RS20145 | 1228562..1229518 | + | 957 | WP_195721999.1 | GntR family transcriptional regulator | - |
| GPY16_RS20150 | 1229872..1232028 | + | 2157 | WP_158105924.1 | TonB-dependent receptor | - |
| GPY16_RS20155 | 1232295..1233149 | - | 855 | WP_011081921.1 | tagatose bisphosphate family class II aldolase | - |
| GPY16_RS20160 | 1233140..1234333 | - | 1194 | WP_046029364.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| GPY16_RS20165 | 1234323..1234778 | - | 456 | WP_011081923.1 | PTS sugar transporter subunit IIA | - |
| GPY16_RS20170 | 1234859..1235743 | - | 885 | WP_017421416.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| GPY16_RS20175 | 1235733..1236509 | - | 777 | WP_011081925.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| GPY16_RS20180 | 1236526..1236999 | - | 474 | WP_011081926.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| GPY16_RS20185 | 1237011..1238186 | - | 1176 | WP_158105925.1 | AgaS family sugar isomerase | - |
| GPY16_RS20190 | 1238186..1239493 | - | 1308 | WP_158105926.1 | D-tagatose-bisphosphate aldolase, class II, non-catalytic subunit | - |
| GPY16_RS20195 | 1239502..1240290 | - | 789 | WP_026050515.1 | DeoR family transcriptional regulator | - |
| GPY16_RS20200 | 1240622..1241392 | - | 771 | WP_039536829.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| GPY16_RS20205 | 1241481..1242395 | - | 915 | WP_103197613.1 | EamA family transporter | - |
| GPY16_RS20210 | 1242497..1243209 | - | 713 | Protein_1028 | helix-turn-helix domain-containing protein | - |
| GPY16_RS20215 | 1243386..1244165 | + | 780 | WP_199245030.1 | choline kinase | - |
| GPY16_RS20220 | 1244221..1245420 | - | 1200 | WP_038963242.1 | type III PLP-dependent enzyme | - |
| GPY16_RS20225 | 1245791..1249270 | - | 3480 | WP_039536815.1 | response regulator | - |
| GPY16_RS20230 | 1249289..1250254 | - | 966 | WP_158105927.1 | diguanylate cyclase | - |
| GPY16_RS20235 | 1250443..1251903 | + | 1461 | WP_158105928.1 | diguanylate cyclase | - |
| GPY16_RS20240 | 1251918..1252925 | + | 1008 | WP_158105929.1 | GGDEF domain-containing phosphodiesterase | - |
| GPY16_RS20245 | 1253037..1253936 | + | 900 | WP_158105930.1 | LysR family transcriptional regulator | - |
| GPY16_RS20250 | 1254080..1256047 | + | 1968 | WP_038963240.1 | MBL fold metallo-hydrolase | - |
| GPY16_RS20255 | 1256158..1256694 | - | 537 | WP_039448724.1 | N-acetyltransferase | - |
| GPY16_RS20260 | 1256836..1257369 | + | 534 | WP_045589773.1 | dihydrofolate reductase family protein | - |
| GPY16_RS20265 | 1257463..1258071 | + | 609 | WP_038964007.1 | exopolysaccharide biosynthesis protein | - |
| GPY16_RS20270 | 1258136..1259140 | - | 1005 | WP_199245062.1 | sel1 repeat family protein | - |
| GPY16_RS20275 | 1259336..1259791 | + | 456 | WP_026130967.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| GPY16_RS20280 | 1259788..1260315 | + | 528 | WP_017421398.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
| GPY16_RS20285 | 1260468..1260716 | + | 249 | WP_011081943.1 | DUF3297 family protein | - |
| GPY16_RS20290 | 1260921..1261178 | + | 258 | WP_095429678.1 | DUF2999 family protein | - |
| GPY16_RS20295 | 1261269..1262621 | - | 1353 | WP_158105932.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS20300 | 1262630..1264609 | - | 1980 | WP_103182045.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS20305 | 1265094..1265822 | + | 729 | WP_158105933.1 | hypothetical protein | - |
| GPY16_RS20310 | 1265889..1266374 | - | 486 | WP_011081948.1 | DUF417 family protein | - |
| GPY16_RS20315 | 1266419..1266688 | - | 270 | WP_011081949.1 | glutaredoxin 3 | - |
| GPY16_RS20320 | 1266803..1267651 | + | 849 | WP_038964001.1 | AraC family transcriptional regulator | - |
| GPY16_RS20325 | 1267709..1269481 | - | 1773 | WP_158105934.1 | PKD domain-containing protein | - |
| GPY16_RS20330 | 1269862..1270557 | + | 696 | WP_038939692.1 | hypothetical protein | - |
| GPY16_RS20335 | 1270669..1271586 | - | 918 | WP_039536786.1 | LysR family transcriptional regulator | - |
| GPY16_RS20340 | 1271702..1273015 | + | 1314 | WP_158105935.1 | 6-phospho-beta-glucosidase | - |
| GPY16_RS20345 | 1273064..1274056 | - | 993 | WP_158105936.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| GPY16_RS20350 | 1274145..1274963 | - | 819 | WP_045593567.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS20355 | 1275048..1275290 | + | 243 | WP_026050507.1 | hypothetical protein | - |
| GPY16_RS20360 | 1275336..1276025 | + | 690 | WP_158105937.1 | MOSC domain-containing protein | - |
| GPY16_RS20365 | 1276378..1277928 | + | 1551 | WP_052687767.1 | hypothetical protein | - |
| GPY16_RS20370 | 1278067..1278459 | - | 393 | WP_020834995.1 | hypothetical protein | - |
| GPY16_RS20375 | 1278817..1279731 | - | 915 | WP_158106091.1 | helix-turn-helix domain-containing protein | - |
| GPY16_RS20380 | 1279850..1280368 | + | 519 | WP_097353618.1 | cysteine hydrolase | - |
| GPY16_RS20385 | 1280528..1281766 | - | 1239 | WP_158105938.1 | DEAD/DEAH box helicase | - |
| GPY16_RS20390 | 1281975..1283162 | - | 1188 | WP_045610099.1 | mannonate dehydratase | - |
| GPY16_RS20395 | 1283292..1284083 | - | 792 | WP_011081967.1 | FCD domain-containing protein | - |
| GPY16_RS20400 | 1284191..1285174 | - | 984 | WP_026050503.1 | TRAP transporter substrate-binding protein | - |
| GPY16_RS20405 | 1285497..1286012 | + | 516 | WP_005461368.1 | TRAP transporter small permease | - |
| GPY16_RS20410 | 1286024..1287325 | + | 1302 | WP_005461370.1 | TRAP transporter large permease | - |
| GPY16_RS20415 | 1287377..1288840 | + | 1464 | WP_158105939.1 | fructuronate reductase | - |
| GPY16_RS20420 | 1288853..1290265 | + | 1413 | WP_158105940.1 | glucuronate isomerase | - |
| GPY16_RS20425 | 1290269..1291246 | + | 978 | WP_158105941.1 | sugar kinase | - |
| GPY16_RS20430 | 1291256..1291885 | + | 630 | WP_158105942.1 | bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase | - |
| GPY16_RS20435 | 1291980..1292501 | + | 522 | WP_017421374.1 | YgjV family protein | - |
| GPY16_RS20440 | 1292477..1293403 | - | 927 | WP_094867395.1 | LysR family transcriptional regulator | - |
| GPY16_RS20445 | 1293525..1294193 | + | 669 | WP_158105943.1 | SDR family oxidoreductase | - |
| GPY16_RS20450 | 1294294..1295481 | + | 1188 | WP_039536739.1 | MFS transporter | - |
| GPY16_RS20455 | 1295560..1296189 | + | 630 | WP_039536736.1 | GrxB family glutaredoxin | - |
| GPY16_RS20460 | 1296200..1297294 | + | 1095 | WP_039536733.1 | alkene reductase | - |
| GPY16_RS20465 | 1297324..1297821 | - | 498 | Protein_1079 | group II intron reverse transcriptase/maturase | - |
| GPY16_RS20470 | 1297967..1298200 | + | 234 | WP_080721687.1 | hypothetical protein | - |
| GPY16_RS20475 | 1298320..1298688 | - | 369 | WP_039536730.1 | hypothetical protein | - |
| GPY16_RS20480 | 1298693..1299001 | - | 309 | WP_039536727.1 | monooxygenase | - |
| GPY16_RS20485 | 1299112..1300002 | + | 891 | WP_045593614.1 | LysR family transcriptional regulator | - |
| GPY16_RS20490 | 1300064..1300615 | - | 552 | Protein_1084 | substrate binding domain-containing protein | - |
| GPY16_RS20495 | 1300619..1300963 | + | 345 | Protein_1085 | alkene reductase | - |
| GPY16_RS20500 | 1301009..1302076 | - | 1068 | WP_017421368.1 | L-ascorbate 6-phosphate lactonase | - |
| GPY16_RS20505 | 1302200..1302955 | - | 756 | WP_011081979.1 | HTH-type transcriptional regulator UlaR | - |
| GPY16_RS20510 | 1303342..1305102 | + | 1761 | WP_158105944.1 | PTS ascorbate-specific subunit IIBC | - |
| GPY16_RS20515 | 1305172..1305648 | + | 477 | WP_045593619.1 | PTS sugar transporter subunit IIA | - |
| GPY16_RS20520 | 1305658..1306350 | + | 693 | WP_017421365.1 | L-ribulose-5-phosphate 4-epimerase | - |
| GPY16_RS20525 | 1306355..1307176 | + | 822 | WP_045593620.1 | Cof-type HAD-IIB family hydrolase | - |
| GPY16_RS20530 | 1307182..1307829 | + | 648 | WP_017421363.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| GPY16_RS20535 | 1307838..1308719 | + | 882 | WP_039448669.1 | L-ribulose-5-phosphate 3-epimerase | - |
| GPY16_RS20540 | 1308942..1309370 | + | 429 | WP_026050500.1 | hypothetical protein | - |
| GPY16_RS20545 | 1309462..1310439 | - | 978 | WP_158105945.1 | amidinotransferase | - |
| GPY16_RS20550 | 1310774..1312633 | + | 1860 | WP_039547741.1 | ABC transporter ATP-binding protein/permease | - |
| GPY16_RS20555 | 1312707..1314755 | - | 2049 | WP_158105946.1 | polysaccharide lyase 8 family protein | - |
| GPY16_RS20560 | 1314822..1317008 | - | 2187 | WP_158105947.1 | 1,3-beta-galactosyl-N-acetylhexosamine phosphorylase | - |
| GPY16_RS20565 | 1317074..1318243 | - | 1170 | WP_046029716.1 | glycoside hydrolase family 88 protein | - |
| GPY16_RS20570 | 1318422..1319183 | - | 762 | WP_017791337.1 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD | - |
| GPY16_RS20575 | 1319314..1320360 | - | 1047 | WP_158105948.1 | UDP-glucose--hexose-1-phosphate uridylyltransferase | - |
| GPY16_RS20580 | 1320377..1321393 | - | 1017 | WP_158105949.1 | UDP-glucose 4-epimerase GalE | - |
| GPY16_RS20585 | 1321390..1323021 | - | 1632 | WP_039547755.1 | SulP family inorganic anion transporter | - |
| GPY16_RS20590 | 1324162..1325601 | + | 1440 | WP_158105950.1 | OprD family outer membrane porin | - |
| GPY16_RS20595 | 1325673..1326224 | - | 552 | WP_039547758.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS20600 | 1326317..1326766 | + | 450 | WP_045590995.1 | HPP family protein | - |
| GPY16_RS20605 | 1326864..1328810 | - | 1947 | WP_158105951.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS20610 | 1328902..1330602 | - | 1701 | WP_039547764.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS20615 | 1330605..1331765 | - | 1161 | WP_039547767.1 | ABC transporter permease | - |
| GPY16_RS20620 | 1331768..1332775 | - | 1008 | WP_039547770.1 | ABC transporter permease | - |
| GPY16_RS20625 | 1333728..1335647 | - | 1920 | WP_045610075.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS20630 | 1335715..1337436 | - | 1722 | WP_094867404.1 | DUF2264 domain-containing protein | - |
| GPY16_RS20635 | 1337637..1339097 | + | 1461 | WP_158105952.1 | sulfatase-like hydrolase/transferase | - |
| GPY16_RS20640 | 1339120..1340331 | - | 1212 | WP_158105953.1 | anaerobic sulfatase maturase | - |
| GPY16_RS20645 | 1340493..1341986 | + | 1494 | WP_045591008.1 | sulfatase | - |
| GPY16_RS20650 | 1341983..1343449 | + | 1467 | WP_103190179.1 | arylsulfatase | - |
| GPY16_RS20655 | 1343525..1346101 | - | 2577 | WP_158105954.1 | DNRLRE domain-containing protein | - |
| GPY16_RS20660 | 1346411..1347115 | + | 705 | WP_011082010.1 | DUF445 family protein | - |
| GPY16_RS20665 | 1347226..1347720 | - | 495 | WP_011082011.1 | Lrp/AsnC family transcriptional regulator | - |
| GPY16_RS22495 | 1348597..1348761 | + | 165 | WP_017421358.1 | hypothetical protein | - |
| GPY16_RS20670 | 1348772..1349023 | - | 252 | WP_072599289.1 | hypothetical protein | - |
| GPY16_RS20675 | 1349352..1350845 | - | 1494 | WP_011082013.1 | sodium/proline symporter PutP | - |
| GPY16_RS20680 | 1350915..1351622 | - | 708 | WP_011082014.1 | 1-pyrroline-5-carboxylate dehydrogenase | - |
| GPY16_RS20685 | 1351634..1354765 | - | 3132 | WP_158105955.1 | bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA | - |
| GPY16_RS20690 | 1354949..1355767 | - | 819 | WP_038939667.1 | AraC family transcriptional regulator | - |
| GPY16_RS20695 | 1356311..1357051 | + | 741 | WP_017421354.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS20700 | 1357101..1357736 | - | 636 | WP_011082018.1 | pyridoxamine 5'-phosphate oxidase | - |
| GPY16_RS20705 | 1357949..1359760 | + | 1812 | WP_158105956.1 | GHKL domain-containing protein | - |
| GPY16_RS20710 | 1359757..1360986 | + | 1230 | WP_158105957.1 | response regulator | - |
| GPY16_RS20715 | 1361089..1362480 | + | 1392 | WP_017421350.1 | HlyD family type I secretion periplasmic adaptor subunit | - |
| GPY16_RS20720 | 1362464..1363201 | + | 738 | WP_017421349.1 | transglutaminase-like cysteine peptidase | - |
| GPY16_RS20725 | 1363207..1365120 | + | 1914 | WP_026050496.1 | EAL domain-containing protein | - |
| GPY16_RS20730 | 1365133..1367247 | + | 2115 | WP_011152840.1 | type I secretion system permease/ATPase | - |
| GPY16_RS20735 | 1367412..1367966 | + | 555 | WP_158105958.1 | flavodoxin family protein | - |
| GPY16_RS20740 | 1368005..1369471 | - | 1467 | WP_158105959.1 | C4-dicarboxylate transporter DcuC | - |
| GPY16_RS20745 | 1369481..1370617 | - | 1137 | WP_102982458.1 | beta-aspartyl-peptidase | - |
| GPY16_RS20750 | 1370797..1371699 | + | 903 | WP_017421344.1 | LysR family transcriptional regulator | - |
| GPY16_RS20755 | 1371812..1372024 | - | 213 | WP_080931254.1 | hypothetical protein | - |
| GPY16_RS20760 | 1372073..1373671 | - | 1599 | WP_158105960.1 | chaperonin GroEL | - |
| GPY16_RS20765 | 1373706..1373996 | - | 291 | WP_011082031.1 | co-chaperone GroES | - |
| GPY16_RS20775 | 1374163..1374729 | - | 567 | WP_199245063.1 | sugar O-acetyltransferase | - |
| GPY16_RS20780 | 1375156..1376241 | + | 1086 | WP_158105962.1 | YdcF family protein | - |
| GPY16_RS20785 | 1376311..1377525 | - | 1215 | WP_011082035.1 | RsmB/NOP family class I SAM-dependent RNA methyltransferase | - |
| GPY16_RS20790 | 1377803..1379479 | + | 1677 | WP_158105963.1 | amidohydrolase | - |
| GPY16_RS20795 | 1379517..1380365 | - | 849 | WP_158105964.1 | SIS domain-containing protein | - |
| GPY16_RS20800 | 1380612..1381514 | + | 903 | WP_026050237.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| GPY16_RS20805 | 1381540..1383000 | + | 1461 | WP_039547815.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
| GPY16_RS20810 | 1383166..1384224 | + | 1059 | WP_158105965.1 | porin | - |
| GPY16_RS20815 | 1384280..1385023 | - | 744 | WP_026050239.1 | EAL domain-containing protein | - |
| GPY16_RS20820 | 1385264..1385878 | - | 615 | WP_039547819.1 | histidine phosphatase family protein | - |
| GPY16_RS20825 | 1386157..1388589 | + | 2433 | WP_158105966.1 | M9 family metallopeptidase | - |
| GPY16_RS20830 | 1388794..1389456 | - | 663 | WP_017419920.1 | hypothetical protein | - |
| GPY16_RS20835 | 1390648..1391127 | + | 480 | WP_045591052.1 | DUF1456 family protein | - |
| GPY16_RS20840 | 1391557..1393890 | - | 2334 | WP_158105967.1 | AAA family ATPase | - |
| GPY16_RS20845 | 1393865..1394530 | - | 666 | WP_046029671.1 | hypothetical protein | - |
| GPY16_RS20850 | 1394511..1395740 | - | 1230 | WP_080938901.1 | hypothetical protein | - |
| GPY16_RS20855 | 1396122..1396760 | + | 639 | WP_158105968.1 | peptidase M15 | - |
| GPY16_RS20860 | 1396791..1398464 | - | 1674 | WP_158105969.1 | FapA family protein | - |
| GPY16_RS20865 | 1398686..1400362 | - | 1677 | WP_038939279.1 | fused response regulator/phosphatase | - |
| GPY16_RS20870 | 1400377..1400676 | - | 300 | WP_011082053.1 | STAS domain-containing protein | - |
| GPY16_RS20875 | 1400717..1401889 | - | 1173 | WP_039452508.1 | chemotaxis protein | - |
| GPY16_RS20880 | 1401941..1402975 | - | 1035 | WP_072614598.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| GPY16_RS20885 | 1402975..1403619 | - | 645 | WP_038939276.1 | chemoreceptor glutamine deamidase CheD | - |
| GPY16_RS20890 | 1403635..1404489 | - | 855 | WP_130350730.1 | protein-glutamate O-methyltransferase CheR | - |
| GPY16_RS20895 | 1404474..1406897 | - | 2424 | WP_158105970.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS20900 | 1406906..1407367 | - | 462 | WP_026050241.1 | chemotaxis protein CheW | - |
| GPY16_RS20905 | 1407367..1407873 | - | 507 | WP_130251693.1 | chemotaxis protein CheW | - |
| GPY16_RS20910 | 1407883..1409997 | - | 2115 | WP_158105971.1 | chemotaxis protein CheA | - |
| GPY16_RS20915 | 1410032..1410391 | - | 360 | WP_011082062.1 | response regulator | - |
| GPY16_RS20920 | 1410423..1410677 | - | 255 | WP_011082063.1 | STAS domain-containing protein | - |
| GPY16_RS20925 | 1411012..1413039 | - | 2028 | WP_158105972.1 | GNAT family N-acetyltransferase | - |
| GPY16_RS20930 | 1413138..1414112 | - | 975 | WP_038968854.1 | ParB/RepB/Spo0J family partition protein | - |
| GPY16_RS20935 | 1414120..1415337 | - | 1218 | WP_011082066.1 | AAA family ATPase | - |
| GPY16_RS20940 | 1416746..1418716 | + | 1971 | WP_011082067.1 | DUF3346 domain-containing protein | - |
| GPY16_RS20945 | 1419069..1419536 | - | 468 | WP_017419903.1 | hypothetical protein | - |
| GPY16_RS20950 | 1419536..1420468 | - | 933 | WP_046029664.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS20955 | 1420471..1421316 | - | 846 | WP_017419901.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS20960 | 1421666..1421863 | + | 198 | WP_017419900.1 | hypothetical protein | - |
| GPY16_RS20965 | 1422057..1423111 | + | 1055 | Protein_1179 | GTP cyclohydrolase II | - |
| GPY16_RS20970 | 1423156..1423911 | - | 756 | WP_158105973.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS20975 | 1423987..1425927 | + | 1941 | WP_158105974.1 | response regulator | - |
| GPY16_RS20980 | 1426086..1426295 | + | 210 | WP_011082075.1 | DUF3283 family protein | - |
| GPY16_RS20985 | 1426426..1427142 | + | 717 | WP_015727328.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| GPY16_RS20990 | 1427177..1427349 | - | 173 | Protein_1184 | DUF2798 domain-containing protein | - |
| GPY16_RS20995 | 1427487..1428217 | + | 731 | Protein_1185 | hypothetical protein | - |
| GPY16_RS21000 | 1428228..1428923 | + | 696 | WP_046029661.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS21005 | 1428911..1430176 | + | 1266 | WP_045591076.1 | ABC transporter permease | - |
| GPY16_RS21010 | 1430169..1430939 | + | 771 | WP_017419892.1 | outer membrane lipoprotein-sorting protein | - |
| GPY16_RS21015 | 1430959..1432293 | + | 1335 | WP_158105975.1 | hypothetical protein | - |
| GPY16_RS21020 | 1432294..1433397 | + | 1104 | WP_158105976.1 | histidine kinase | - |
| GPY16_RS21025 | 1433394..1434164 | + | 771 | WP_158105977.1 | LytTR family DNA-binding domain-containing protein | - |
| GPY16_RS21030 | 1434353..1436014 | - | 1662 | WP_038964030.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS21035 | 1436228..1437019 | - | 792 | WP_199245031.1 | DUF4344 domain-containing metallopeptidase | - |
| GPY16_RS21040 | 1437642..1438868 | + | 1227 | WP_011082090.1 | sodium/glutamate symporter | - |
| GPY16_RS21045 | 1439330..1440556 | + | 1227 | WP_158105979.1 | sodium/glutamate symporter | - |
| GPY16_RS21050 | 1440712..1441578 | + | 867 | WP_039449331.1 | hypothetical protein | - |
| GPY16_RS21055 | 1441683..1442483 | - | 801 | WP_038939254.1 | glucosamine-6-phosphate deaminase | - |
| GPY16_RS21060 | 1442805..1443056 | + | 252 | WP_026050244.1 | DUF3081 domain-containing protein | - |
| GPY16_RS21065 | 1443119..1443337 | - | 219 | WP_130251702.1 | DUF1704 domain-containing protein | - |
| GPY16_RS21070 | 1443344..1443638 | - | 295 | Protein_1200 | hypothetical protein | - |
| GPY16_RS21075 | 1443638..1443997 | - | 360 | WP_017419884.1 | DUF413 domain-containing protein | - |
| GPY16_RS21080 | 1444147..1445046 | + | 900 | WP_017419883.1 | LysR family transcriptional regulator | - |
| GPY16_RS21085 | 1445166..1445369 | - | 204 | WP_011082099.1 | hypothetical protein | - |
| GPY16_RS21090 | 1445736..1447121 | + | 1386 | WP_199245032.1 | helix-turn-helix domain-containing protein | - |
| GPY16_RS21095 | 1447123..1447608 | + | 486 | WP_017419881.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| GPY16_RS21100 | 1447793..1448611 | + | 819 | WP_097352458.1 | hypothetical protein | - |
| GPY16_RS21105 | 1448669..1449277 | - | 609 | WP_017419880.1 | YitT family protein | - |
| GPY16_RS21110 | 1449488..1449883 | + | 396 | WP_039538709.1 | GFA family protein | - |
| GPY16_RS21115 | 1449962..1451398 | - | 1437 | WP_045628500.1 | sodium:proton antiporter NhaD | - |
| GPY16_RS21120 | 1451818..1452837 | - | 1020 | WP_199245033.1 | acyltransferase family protein | - |
| GPY16_RS21125 | 1453056..1453649 | + | 594 | WP_017419876.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS21130 | 1453729..1454577 | + | 849 | WP_170861636.1 | alpha/beta hydrolase | - |
| GPY16_RS21135 | 1454685..1457222 | - | 2538 | WP_158105982.1 | chitinase | - |
| GPY16_RS21140 | 1457542..1458051 | - | 510 | WP_017419873.1 | DUF2850 domain-containing protein | - |
| GPY16_RS21145 | 1458267..1458548 | + | 282 | WP_011082111.1 | pyrimidine/purine nucleoside phosphorylase | - |
| GPY16_RS21150 | 1458644..1459489 | - | 846 | WP_039536593.1 | pirin family protein | - |
| GPY16_RS21160 | 1459966..1461162 | - | 1197 | WP_039547882.1 | GGDEF domain-containing protein | - |
| GPY16_RS21165 | 1461811..1468116 | + | 6306 | WP_158105983.1 | VCBS repeat-containing protein | - |
| GPY16_RS21170 | 1468132..1468545 | + | 414 | WP_138972754.1 | hypothetical protein | - |
| GPY16_RS21175 | 1468576..1468899 | - | 324 | Protein_1220 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS21180 | 1469138..1469581 | + | 444 | WP_199245034.1 | hypothetical protein | - |
| GPY16_RS21185 | 1469578..1469997 | + | 420 | WP_158105984.1 | immunity protein 39 | - |
| GPY16_RS21190 | 1470643..1472418 | - | 1776 | WP_158105985.1 | diguanylate cyclase | - |
| GPY16_RS21195 | 1472573..1474558 | - | 1986 | WP_199245035.1 | glycogen debranching protein GlgX | - |
| GPY16_RS21200 | 1474992..1476263 | + | 1272 | WP_199245036.1 | carbohydrate porin | - |
| GPY16_RS21205 | 1476339..1477190 | + | 852 | WP_199245037.1 | transcriptional regulator | - |
| GPY16_RS21210 | 1477306..1480086 | - | 2781 | WP_158105989.1 | amylo-alpha-1,6-glucosidase | - |
| GPY16_RS21215 | 1480148..1481326 | - | 1179 | WP_017789926.1 | maltose/maltodextrin ABC transporter substrate-binding protein MalE | - |
| GPY16_RS21220 | 1481553..1483343 | - | 1791 | WP_199245038.1 | alpha-amylase family protein | - |
| GPY16_RS21225 | 1483567..1484748 | + | 1182 | WP_158105991.1 | sel1 repeat family protein | - |
| GPY16_RS21230 | 1484812..1488423 | - | 3612 | WP_158105992.1 | pullulanase-type alpha-1,6-glucosidase | - |
| GPY16_RS21235 | 1488814..1489077 | + | 264 | WP_158105993.1 | hypothetical protein | - |
| GPY16_RS21240 | 1489276..1489722 | + | 447 | WP_038939235.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS21245 | 1490133..1492313 | + | 2181 | WP_158105995.1 | ornithine decarboxylase SpeF | - |
| GPY16_RS21250 | 1492379..1493689 | + | 1311 | WP_158105996.1 | putrescine-ornithine antiporter | - |
| GPY16_RS21255 | 1494054..1494926 | + | 873 | WP_130200208.1 | pyridoxal kinase PdxY | - |
| GPY16_RS21260 | 1494977..1496197 | - | 1221 | WP_011151497.1 | serine/threonine transporter SstT | - |
| GPY16_RS21265 | 1496524..1497585 | - | 1062 | WP_158105997.1 | ribosome small subunit-dependent GTPase A | - |
| GPY16_RS21270 | 1497898..1498347 | - | 450 | WP_017421715.1 | copper chaperone PCu(A)C | - |
| GPY16_RS21275 | 1498349..1498948 | - | 600 | WP_039448799.1 | SCO family protein | - |
| GPY16_RS21280 | 1498945..1499388 | - | 444 | WP_045591113.1 | hypothetical protein | - |
| GPY16_RS21285 | 1499524..1500444 | - | 921 | WP_086017375.1 | DUF368 domain-containing protein | - |
| GPY16_RS21290 | 1500969..1501976 | - | 1008 | WP_158105998.1 | hypothetical protein | - |
| GPY16_RS21295 | 1501996..1503039 | - | 1044 | WP_158105999.1 | hypothetical protein | - |
| GPY16_RS21300 | 1503359..1506067 | - | 2709 | WP_038939225.1 | HTH-type transcriptional regulator MalT | - |
| GPY16_RS21305 | 1506623..1509076 | + | 2454 | WP_158106000.1 | glycogen/starch/alpha-glucan phosphorylase | - |
| GPY16_RS21310 | 1509189..1511369 | + | 2181 | WP_038963200.1 | 4-alpha-glucanotransferase | - |
| GPY16_RS21315 | 1511556..1513784 | + | 2229 | WP_199245039.1 | 1,4-alpha-glucan branching protein GlgB | - |
| GPY16_RS21320 | 1514033..1515442 | + | 1410 | WP_080526964.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| GPY16_RS21325 | 1515519..1516106 | - | 588 | WP_017791431.1 | LysE family translocator | - |
| GPY16_RS21330 | 1516228..1516668 | + | 441 | WP_026050595.1 | Lrp/AsnC family transcriptional regulator | - |
| GPY16_RS21335 | 1516665..1517852 | - | 1188 | WP_158106002.1 | hypothetical protein | - |
| GPY16_RS21340 | 1517937..1518575 | - | 639 | WP_017421744.1 | pyroglutamyl-peptidase I | - |
| GPY16_RS21345 | 1519008..1520189 | + | 1182 | WP_158106003.1 | lytic polysaccharide monooxygenase | - |
| GPY16_RS21350 | 1520309..1520977 | - | 669 | WP_039536535.1 | porin family protein | - |
| GPY16_RS21355 | 1521335..1524106 | + | 2772 | WP_158106004.1 | hypothetical protein | - |
| GPY16_RS21360 | 1524223..1524825 | - | 603 | WP_199245040.1 | HAD-IB family hydrolase | - |
| GPY16_RS21365 | 1525040..1526662 | + | 1623 | WP_038963207.1 | methyl-accepting chemotaxis protein | - |
| GPY16_RS21370 | 1526731..1527276 | - | 546 | WP_046029620.1 | hypothetical protein | - |
| GPY16_RS21375 | 1527383..1528162 | - | 780 | WP_158106006.1 | EAL domain-containing protein | - |
| GPY16_RS21380 | 1528381..1529808 | + | 1428 | WP_158106007.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| GPY16_RS21385 | 1529962..1530819 | + | 858 | WP_158106008.1 | glutathione-dependent disulfide-bond oxidoreductase | - |
| GPY16_RS21390 | 1530956..1532281 | - | 1326 | WP_046029616.1 | HD domain-containing protein | - |
| GPY16_RS21395 | 1532425..1534233 | - | 1809 | WP_130346386.1 | Na/Pi cotransporter family protein | - |
| GPY16_RS21400 | 1534423..1537170 | + | 2748 | WP_158106009.1 | insulinase family protein | - |
| GPY16_RS21405 | 1537281..1537766 | - | 486 | WP_026050592.1 | VOC family protein | - |
| GPY16_RS21410 | 1537955..1538833 | + | 879 | WP_017421756.1 | LysR family transcriptional regulator | - |
| GPY16_RS21415 | 1538911..1539717 | + | 807 | WP_158106010.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS21420 | 1539829..1541247 | - | 1419 | WP_199245041.1 | sensor histidine kinase N-terminal domain-containing protein | - |
| GPY16_RS21425 | 1541237..1541893 | - | 657 | WP_017421758.1 | response regulator | - |
| GPY16_RS21430 | 1541897..1542526 | - | 630 | WP_038968321.1 | hypothetical protein | - |
| GPY16_RS21435 | 1542540..1543346 | - | 807 | WP_039536466.1 | SDR family oxidoreductase | - |
| GPY16_RS21440 | 1543356..1545548 | - | 2193 | WP_158106011.1 | AMP-binding protein | - |
| GPY16_RS21445 | 1545558..1546100 | - | 543 | WP_170937781.1 | thermostable hemolysin | - |
| GPY16_RS21450 | 1546361..1547452 | - | 1092 | WP_158106012.1 | GGDEF domain-containing protein | - |
| GPY16_RS21455 | 1547467..1547928 | - | 462 | WP_017421760.1 | molybdopterin-dependent oxidoreductase | - |
| GPY16_RS21460 | 1548425..1548556 | + | 132 | Protein_1277 | carbohydrate porin | - |
| GPY16_RS21465 | 1548749..1549753 | + | 1005 | WP_017421763.1 | LacI family transcriptional regulator | - |
| GPY16_RS21470 | 1549774..1551018 | + | 1245 | WP_017421764.1 | extracellular solute-binding protein | - |
| GPY16_RS21475 | 1551109..1552098 | + | 990 | WP_038939207.1 | sugar ABC transporter permease | - |
| GPY16_RS21480 | 1552100..1552981 | + | 882 | WP_011082173.1 | carbohydrate ABC transporter permease | - |
| GPY16_RS21485 | 1553012..1554361 | + | 1350 | WP_158106013.1 | beta-glucosidase | - |
| GPY16_RS21490 | 1554361..1555458 | + | 1098 | WP_039448760.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| GPY16_RS21495 | 1555610..1556632 | + | 1023 | WP_158106014.1 | substrate-binding domain-containing protein | - |
| GPY16_RS21500 | 1556655..1557428 | - | 774 | WP_038963219.1 | transporter substrate-binding domain-containing protein | - |
| GPY16_RS21505 | 1557919..1559556 | + | 1638 | WP_026050588.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS21510 | 1559624..1560598 | + | 975 | WP_017421770.1 | ABC transporter permease | - |
| GPY16_RS21515 | 1560607..1561599 | + | 993 | WP_017421771.1 | ABC transporter permease | - |
| GPY16_RS21520 | 1561596..1562549 | + | 954 | WP_038963221.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS21525 | 1562561..1563547 | + | 987 | WP_020480152.1 | ABC transporter ATP-binding protein | - |
| GPY16_RS21530 | 1563611..1567060 | + | 3450 | WP_158106015.1 | hypothetical protein | - |
| GPY16_RS21535 | 1567310..1568320 | - | 1011 | WP_017421775.1 | LacI family DNA-binding transcriptional regulator | - |
| GPY16_RS21540 | 1568733..1570580 | + | 1848 | WP_158106016.1 | hypothetical protein | - |
| GPY16_RS21545 | 1570685..1572286 | + | 1602 | WP_158106017.1 | glycoside hydrolase family 16 protein | - |
| GPY16_RS21550 | 1572669..1573952 | + | 1284 | WP_038939196.1 | carbohydrate porin | - |
| GPY16_RS21555 | 1574120..1574989 | - | 870 | WP_017421779.1 | helix-turn-helix domain-containing protein | - |
| GPY16_RS21560 | 1575102..1577917 | + | 2816 | Protein_1297 | glycoside hydrolase family 3 protein | - |
| GPY16_RS21565 | 1578088..1579428 | + | 1341 | WP_039541129.1 | MATE family efflux transporter | - |
| GPY16_RS21570 | 1579589..1580086 | + | 498 | WP_158106018.1 | permease | - |
| GPY16_RS21575 | 1580100..1581206 | + | 1107 | WP_039541139.1 | HlyD family secretion protein | - |
| GPY16_RS21580 | 1581196..1582206 | + | 1011 | WP_017421784.1 | DUF2955 domain-containing protein | - |
| GPY16_RS21585 | 1582311..1583309 | - | 999 | WP_103163425.1 | hypothetical protein | - |
| GPY16_RS21590 | 1583863..1585260 | + | 1398 | WP_158106095.1 | DUF4041 domain-containing protein | - |
| GPY16_RS21595 | 1585498..1586433 | + | 936 | WP_039541154.1 | hypothetical protein | - |
| GPY16_RS21600 | 1586570..1588267 | - | 1698 | WP_045609953.1 | pseudouridine synthase | - |
| GPY16_RS21605 | 1588354..1589322 | - | 969 | WP_158106019.1 | sensor domain-containing diguanylate cyclase | - |
| GPY16_RS21610 | 1589454..1592555 | - | 3102 | WP_045609951.1 | efflux RND transporter permease subunit | - |
| GPY16_RS21615 | 1592552..1593874 | - | 1323 | WP_158106020.1 | HlyD family secretion protein | - |
| GPY16_RS21620 | 1593861..1594517 | - | 657 | WP_038939180.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS21625 | 1594641..1595648 | - | 1008 | WP_158106021.1 | substrate-binding domain-containing protein | - |
| GPY16_RS21630 | 1595830..1596837 | - | 1008 | WP_011082207.1 | galactose/methyl galactoside ABC transporter permease MglC | - |
| GPY16_RS21635 | 1596848..1598356 | - | 1509 | WP_017421794.1 | galactose/methyl galactoside ABC transporter ATP-binding protein MglA | - |
| GPY16_RS21640 | 1598462..1599436 | - | 975 | WP_011082209.1 | galactose/glucose ABC transporter substrate-binding protein MglB | - |
| GPY16_RS21645 | 1599780..1602875 | - | 3096 | WP_158106022.1 | beta-galactosidase | - |
| GPY16_RS21650 | 1603255..1605372 | + | 2118 | WP_199245042.1 | alpha-galactosidase | - |
| GPY16_RS21655 | 1605721..1607094 | + | 1374 | WP_038964342.1 | melibiose:sodium transporter MelB | - |
| GPY16_RS21660 | 1608342..1609076 | + | 735 | WP_046029555.1 | RNA methyltransferase | - |
| GPY16_RS21665 | 1609188..1609511 | - | 324 | WP_011082218.1 | ferredoxin family protein | - |
| GPY16_RS21670 | 1609800..1611416 | + | 1617 | WP_039548001.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| GPY16_RS21675 | 1611563..1612282 | - | 720 | WP_172665057.1 | GntR family transcriptional regulator | - |
| GPY16_RS21680 | 1612542..1614482 | + | 1941 | WP_038939173.1 | PTS 2-O-a-mannosyl-D-glycerate transporter subunit IIABC | - |
| GPY16_RS21685 | 1614609..1617263 | + | 2655 | WP_158106024.1 | mannosylglycerate hydrolase | - |
| GPY16_RS21690 | 1617338..1618498 | + | 1161 | WP_080533553.1 | glycerate kinase | - |
| GPY16_RS21695 | 1618491..1619684 | + | 1194 | WP_045591228.1 | mannose-6-phosphate isomerase, class I | - |
| GPY16_RS21700 | 1619982..1622162 | - | 2181 | WP_158106025.1 | TonB-dependent siderophore receptor | - |
| GPY16_RS21705 | 1622305..1623234 | - | 930 | WP_158106026.1 | AraC family transcriptional regulator | - |
| GPY16_RS21710 | 1623407..1624162 | + | 756 | WP_158106027.1 | siderophore ferric iron reductase | - |
| GPY16_RS21715 | 1624749..1625039 | + | 291 | Protein_1328 | hypothetical protein | - |
| GPY16_RS21720 | 1625111..1626288 | + | 1178 | WP_158105179.1 | IS3 family transposase | - |
| GPY16_RS21730 | 1626557..1627399 | + | 843 | WP_158106028.1 | Mg-dependent DNase | - |
| GPY16_RS21735 | 1627444..1627599 | - | 156 | WP_158106029.1 | hypothetical protein | - |
| GPY16_RS21740 | 1627604..1628674 | - | 1071 | WP_045628627.1 | hypothetical protein | - |
| GPY16_RS21745 | 1628998..1630122 | + | 1125 | WP_038939162.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS21750 | 1630203..1631420 | - | 1218 | WP_045628628.1 | mannose-6-phosphate isomerase, class I | - |
| GPY16_RS21755 | 1631531..1633431 | - | 1901 | Protein_1335 | PTS sugar transporter subunit IIA | - |
| GPY16_RS21760 | 1633848..1634687 | + | 840 | WP_017421815.1 | AraC family transcriptional regulator | - |
| GPY16_RS21765 | 1634679..1635458 | - | 780 | WP_017421816.1 | PTS sugar transporter subunit IIA | - |
| GPY16_RS21770 | 1635467..1635766 | - | 300 | WP_015727454.1 | PTS fructose transporter subunit IIB | - |
| GPY16_RS21775 | 1636008..1637873 | + | 1866 | WP_158106030.1 | fructose-specific PTS transporter subunit EIIC | - |
| GPY16_RS21780 | 1637901..1639283 | - | 1383 | WP_199245043.1 | PLP-dependent aminotransferase family protein | - |
| GPY16_RS21785 | 1639379..1640278 | + | 900 | WP_158106031.1 | EamA family transporter | - |
| GPY16_RS21790 | 1640337..1641740 | - | 1404 | WP_158106032.1 | fructose-specific PTS transporter subunit EIIC | - |
| GPY16_RS21795 | 1641752..1642192 | - | 441 | WP_039548029.1 | PTS sugar transporter subunit IIA | - |
| GPY16_RS21800 | 1642458..1643117 | - | 660 | WP_045628637.1 | HAD-IB family hydrolase | - |
| GPY16_RS21805 | 1643375..1643671 | + | 297 | WP_017421824.1 | hypothetical protein | - |
| GPY16_RS21810 | 1643965..1648164 | + | 4200 | WP_045628638.1 | formate dehydrogenase subunit alpha | - |
| GPY16_RS21815 | 1648332..1650812 | + | 2481 | WP_172665059.1 | glycoside hydrolase family 2 protein | - |
| GPY16_RS21820 | 1650884..1651906 | - | 1023 | WP_017421827.1 | Mal regulon transcriptional regulator MalI | - |
| GPY16_RS21825 | 1652144..1653715 | + | 1572 | WP_017421828.1 | maltose/glucose-specific PTS transporter subunit IIBC | - |
| GPY16_RS21830 | 1653795..1654982 | + | 1188 | WP_045593828.1 | pyridoxal phosphate-dependent aminotransferase | - |
| GPY16_RS21835 | 1654993..1656180 | + | 1188 | WP_045628640.1 | mannose-6-phosphate isomerase, class I | - |
| GPY16_RS21840 | 1656286..1657116 | - | 831 | WP_158106033.1 | xanthosine phosphorylase | - |
| GPY16_RS21845 | 1657230..1658174 | + | 945 | WP_158106034.1 | LysR family transcriptional regulator | - |
| GPY16_RS21850 | 1658196..1660343 | - | 2148 | WP_158106035.1 | M9 family metallopeptidase | - |
| GPY16_RS21855 | 1660742..1661125 | + | 384 | WP_158106036.1 | SirB2 family protein | - |
| GPY16_RS21860 | 1661153..1662364 | - | 1212 | WP_158106037.1 | MFS transporter | - |
| GPY16_RS21865 | 1662455..1664176 | + | 1722 | WP_158106038.1 | SgrR family transcriptional regulator | - |
| GPY16_RS21870 | 1664366..1665208 | + | 843 | WP_101959213.1 | hypothetical protein | - |
| GPY16_RS21875 | 1665381..1666133 | + | 753 | WP_011082253.1 | nicotinamide riboside transporter PnuC | - |
| GPY16_RS21880 | 1666130..1666858 | + | 729 | WP_046029234.1 | nucleoside phosphorylase | - |
| GPY16_RS21885 | 1667046..1667642 | - | 597 | WP_017421839.1 | cold shock and DUF1294 domain-containing protein | - |
| GPY16_RS21890 | 1667900..1668580 | + | 681 | WP_017791471.1 | Crp/Fnr family transcriptional regulator | - |
| GPY16_RS21895 | 1668952..1669845 | + | 894 | WP_038939140.1 | LysR family transcriptional regulator | - |
| GPY16_RS21900 | 1669873..1670199 | - | 327 | WP_158106039.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS21905 | 1670412..1670822 | + | 411 | WP_158106040.1 | nuclear transport factor 2 family protein | - |
| GPY16_RS21910 | 1670924..1671829 | - | 906 | WP_045610203.1 | DMT family transporter | - |
| GPY16_RS21915 | 1671831..1672583 | - | 753 | WP_080533966.1 | 2OG-Fe dioxygenase family protein | - |
| GPY16_RS21920 | 1672595..1673809 | - | 1215 | WP_039468093.1 | argininosuccinate synthase-related protein | - |
| GPY16_RS21925 | 1673914..1674828 | + | 915 | WP_017421845.1 | LysR family transcriptional regulator | - |
| GPY16_RS21930 | 1674932..1676236 | - | 1305 | WP_017421846.1 | dicarboxylate/amino acid:cation symporter | - |
| GPY16_RS21935 | 1676537..1677637 | - | 1101 | WP_045589685.1 | DUF4056 domain-containing protein | - |
| GPY16_RS21940 | 1677644..1678759 | - | 1116 | WP_158106041.1 | BamA/TamA family outer membrane protein | - |
| GPY16_RS21945 | 1678763..1679611 | - | 849 | WP_158106042.1 | TonB-dependent receptor | - |
| GPY16_RS21950 | 1679819..1680418 | + | 600 | WP_172668442.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS21955 | 1680523..1680837 | - | 315 | WP_038939129.1 | hypothetical protein | - |
| GPY16_RS21960 | 1681232..1682134 | + | 903 | WP_017421852.1 | LysR family transcriptional regulator | - |
| GPY16_RS21965 | 1682266..1683111 | + | 846 | WP_045618905.1 | MBL fold metallo-hydrolase | - |
| GPY16_RS21970 | 1683210..1683932 | - | 723 | WP_158106043.1 | oxygen-insensitive NADPH nitroreductase | - |
| GPY16_RS21975 | 1684094..1685224 | + | 1131 | WP_080527035.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
| GPY16_RS21980 | 1685250..1686116 | - | 867 | WP_080931866.1 | TauD/TfdA family dioxygenase | - |
| GPY16_RS21985 | 1686331..1687086 | + | 756 | WP_017421856.1 | helix-turn-helix transcriptional regulator | - |
| GPY16_RS21990 | 1687264..1690932 | + | 3669 | WP_158106044.1 | hypothetical protein | - |
| GPY16_RS21995 | 1691138..1691347 | + | 210 | WP_011082275.1 | hypothetical protein | - |
| GPY16_RS22000 | 1691660..1693402 | - | 1743 | WP_158106045.1 | hypothetical protein | - |
| GPY16_RS22005 | 1693699..1695546 | - | 1848 | WP_158106046.1 | peptidase M3 | - |
| GPY16_RS22010 | 1695678..1697111 | - | 1434 | WP_158106047.1 | PLP-dependent aminotransferase family protein | - |
| GPY16_RS22015 | 1697199..1698104 | + | 906 | WP_130242471.1 | DMT family transporter | - |
| GPY16_RS22020 | 1698076..1699149 | - | 1074 | WP_158106048.1 | sensor domain-containing diguanylate cyclase | - |
| GPY16_RS22025 | 1699338..1699622 | + | 285 | WP_017421864.1 | hypothetical protein | - |
| GPY16_RS22030 | 1699742..1700527 | + | 786 | WP_158106049.1 | ABC transporter substrate-binding protein | - |
| GPY16_RS22035 | 1700609..1702240 | - | 1632 | WP_158106050.1 | endonuclease | - |
| GPY16_RS22040 | 1702518..1704569 | - | 2052 | WP_011151662.1 | glycosidase | - |
| GPY16_RS22045 | 1704784..1705218 | - | 435 | WP_158106051.1 | YccF domain-containing protein | - |
| GPY16_RS22050 | 1705356..1707287 | - | 1932 | WP_199245044.1 | LTA synthase family protein | - |
| GPY16_RS22055 | 1707298..1708950 | - | 1653 | WP_158106052.1 | phosphoethanolamine--lipid A transferase | - |
| GPY16_RS22060 | 1708956..1709312 | - | 357 | WP_011082289.1 | diacylglycerol kinase | - |
| GPY16_RS22065 | 1709644..1710924 | - | 1281 | WP_158106053.1 | HAMP domain-containing protein | - |
| GPY16_RS22070 | 1710934..1711638 | - | 705 | WP_038964168.1 | response regulator | - |
| GPY16_RS22075 | 1711944..1712579 | - | 636 | WP_103163465.1 | NAD(P)-dependent oxidoreductase | - |
| GPY16_RS22080 | 1712699..1713601 | + | 903 | WP_017421874.1 | LysR family transcriptional regulator | - |
| GPY16_RS22085 | 1713636..1714355 | - | 720 | WP_017421875.1 | SDR family oxidoreductase | - |
| GPY16_RS22090 | 1714497..1715411 | + | 915 | WP_072608880.1 | LysR family transcriptional regulator | - |
| GPY16_RS22095 | 1715398..1715748 | - | 351 | WP_017421877.1 | DUF3147 family protein | - |
| GPY16_RS22100 | 1715877..1716173 | - | 297 | WP_046029201.1 | isoamylase early set domain-containing protein | - |
| GPY16_RS22105 | 1716417..1716743 | + | 327 | WP_017421879.1 | hypothetical protein | - |
| GPY16_RS22110 | 1716798..1717397 | + | 600 | WP_175546256.1 | thiol:disulfide interchange protein DsbA/DsbL | - |
| GPY16_RS22115 | 1717530..1719464 | + | 1935 | WP_158106054.1 | glutamate decarboxylase | - |
| GPY16_RS22120 | 1719591..1720247 | - | 657 | WP_017421882.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| GPY16_RS22125 | 1720683..1721222 | + | 540 | WP_158106055.1 | isochorismatase family protein | - |
| GPY16_RS22130 | 1721319..1722122 | + | 804 | WP_038964174.1 | HAD family hydrolase | - |
| GPY16_RS22135 | 1722275..1722565 | + | 291 | WP_017421884.1 | hypothetical protein | - |
| GPY16_RS22140 | 1722950..1723393 | + | 444 | WP_017421885.1 | TetR/AcrR family transcriptional regulator | - |
| GPY16_RS22145 | 1723727..1724475 | - | 749 | Protein_1413 | phosphatase PAP2 family protein | - |
| GPY16_RS22150 | 1724647..1725486 | - | 840 | WP_045589662.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| GPY16_RS22155 | 1725821..1726417 | - | 597 | WP_039541343.1 | tRNA (pseudouridine(54)-N(1))-methyltransferase TrmY | - |
| GPY16_RS22160 | 1726606..1727124 | + | 519 | WP_158106056.1 | DUF3087 domain-containing protein | - |
| GPY16_RS22205 | 1733459..1733815 | - | 357 | WP_011082311.1 | YibL family ribosome-associated protein | - |
| GPY16_RS22210 | 1733921..1734808 | - | 888 | WP_158106057.1 | AraC family transcriptional regulator | - |
| GPY16_RS22215 | 1734946..1736151 | + | 1206 | WP_158106058.1 | sugar efflux transporter | - |
| GPY16_RS22220 | 1736222..1736707 | + | 486 | WP_158106059.1 | L,D-transpeptidase family protein | - |
| GPY16_RS22225 | 1736956..1737843 | + | 888 | WP_158106060.1 | DMT family transporter | - |
| GPY16_RS22230 | 1738005..1738958 | + | 954 | WP_026050405.1 | malate dehydrogenase | - |
| GPY16_RS22235 | 1739191..1740225 | + | 1035 | WP_045613345.1 | spermidine/putrescine ABC transporter substrate-binding protein | - |
| GPY16_RS22240 | 1740508..1742658 | + | 2151 | WP_058666495.1 | TonB-dependent receptor | - |
| GPY16_RS22245 | 1742655..1743194 | + | 540 | WP_158106061.1 | YfiR family protein | - |
| GPY16_RS22250 | 1743191..1745110 | + | 1920 | WP_158106062.1 | diguanylate cyclase | - |
| GPY16_RS22255 | 1745295..1746493 | + | 1199 | Protein_1427 | DUF3103 domain-containing protein | - |
| GPY16_RS22260 | 1746742..1747062 | - | 321 | WP_011082323.1 | heavy metal-binding domain-containing protein | - |
| GPY16_RS22265 | 1747165..1748055 | - | 891 | WP_158106063.1 | LysR family transcriptional regulator | - |
| GPY16_RS22270 | 1748147..1749070 | + | 924 | WP_158106064.1 | DMT family transporter | - |
| GPY16_RS22275 | 1749073..1751952 | - | 2880 | WP_158106065.1 | metal-dependent phosphohydrolase | - |
| GPY16_RS22280 | 1752145..1752585 | + | 441 | WP_038963684.1 | SRPBCC domain-containing protein | - |
| GPY16_RS22285 | 1752668..1753417 | + | 750 | WP_158106066.1 | phosphatase | - |
| GPY16_RS22290 | 1753503..1753904 | + | 402 | WP_017420090.1 | soluble cytochrome b562 | - |
| GPY16_RS22295 | 1754077..1754589 | - | 513 | WP_158106067.1 | superoxide dismutase family protein | - |
| GPY16_RS22300 | 1754589..1755095 | - | 507 | WP_017420092.1 | ankyrin repeat domain-containing protein | - |
| GPY16_RS22305 | 1755188..1756714 | - | 1527 | WP_158106068.1 | catalase | - |
| GPY16_RS22310 | 1757045..1757401 | + | 357 | WP_172665551.1 | hypothetical protein | - |
| GPY16_RS22315 | 1757509..1758924 | + | 1416 | WP_158106069.1 | PepSY domain-containing protein | - |
| GPY16_RS22320 | 1759092..1759475 | - | 384 | WP_158106070.1 | VOC family protein | - |
| GPY16_RS22325 | 1759475..1760386 | - | 912 | WP_038939941.1 | LysR family transcriptional regulator | - |
| GPY16_RS22330 | 1760694..1761935 | + | 1242 | WP_158106071.1 | MFS transporter | - |
| GPY16_RS22335 | 1762058..1762405 | - | 348 | WP_011151705.1 | hypothetical protein | - |
| GPY16_RS22340 | 1762412..1764436 | - | 2025 | WP_045594924.1 | S8 family serine peptidase | - |
| GPY16_RS22345 | 1764877..1766130 | + | 1254 | WP_158106072.1 | SGNH/GDSL hydrolase family protein | - |
| GPY16_RS22350 | 1766404..1767597 | + | 1194 | WP_011082341.1 | glycine C-acetyltransferase | - |
| GPY16_RS22355 | 1767669..1768694 | + | 1026 | WP_197672410.1 | L-threonine 3-dehydrogenase | - |
| GPY16_RS22360 | 1768774..1769274 | - | 501 | WP_158106073.1 | hypothetical protein | - |
| GPY16_RS22365 | 1769352..1769615 | - | 264 | WP_017791548.1 | hypothetical protein | - |
| GPY16_RS22370 | 1769855..1770664 | - | 810 | WP_045628074.1 | SUMF1/EgtB/PvdO family nonheme iron enzyme | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10901.60 Da Isoelectric Point: 4.3430
>T145033 WP_045627860.1 NZ_CP046833:89-367 [Vibrio vulnificus]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLIGVQRDGIRCRLLIIPEISMVISYWVEGDIIRVL
RVLHQKQKFPTD
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLIGVQRDGIRCRLLIIPEISMVISYWVEGDIIRVL
RVLHQKQKFPTD
Download Length: 279 bp
>T145033 NZ_CP062250:2071050-2071424 [Escherichia coli]
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCTCGCCCGTCTCCTGTTGAAATCTGGCAGATACTGCTGTC
CCGACTGCTGGACCAGCACTATGGCCTCACACTGAATGACACACCTTTTGCCGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGTGATGCGGTGAACTTTCTCGTGGAAAAATACGCGCTGGTGCGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGTATCCGGAGGCGAAATGA
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCTCGCCCGTCTCCTGTTGAAATCTGGCAGATACTGCTGTC
CCGACTGCTGGACCAGCACTATGGCCTCACACTGAATGACACACCTTTTGCCGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGTGATGCGGTGAACTTTCTCGTGGAAAAATACGCGCTGGTGCGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATTACCCTGGGTAAGTATCCGGAGGCGAAATGA
Antitoxin
Download Length: -590283.66666667 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT145033 WP_045627858.1 NZ_CP046833:1770944-92 [Vibrio vulnificus]
Download Length: -1770851 bp
>AT145033 NZ_CP062250:2070593-2070961 [Escherichia coli]
GTGTCAGACACACTCCCCGGGACAACACTTCCCGACGACAATCACGACCGCCCCTGGTGGGGGCTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGTAACCGGTTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGCCTGT
TCAGCGATGCAGATGCGTACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGGCTGACCTGCAAAGCCGATACCCTCAGCAGTTG
TGATTACGTTTATCTGGCTGTTTATCCGACGCCCGAAATGAAAAATTAA
GTGTCAGACACACTCCCCGGGACAACACTTCCCGACGACAATCACGACCGCCCCTGGTGGGGGCTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGTAACCGGTTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGCCTGT
TCAGCGATGCAGATGCGTACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGGCTGACCTGCAAAGCCGATACCCTCAGCAGTTG
TGATTACGTTTATCTGGCTGTTTATCCGACGCCCGAAATGAAAAATTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|