145025

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1687968..1688515 Replicon chromosome
Accession NZ_CP046831
Organism Vibrio parahaemolyticus strain 2012AW-0224

Toxin (Protein)


Gene name relE Uniprot ID A0A2K7SRN5
Locus tag GPY55_RS17410 Protein ID WP_010448451.1
Coordinates 1687968..1688270 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag GPY55_RS17415 Protein ID WP_005448240.1
Coordinates 1688258..1688515 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GPY55_RS17360 1683370..1683462 - 93 WP_075111212.1 DUF3265 domain-containing protein -
GPY55_RS17365 1683487..1683876 - 390 WP_083135236.1 hypothetical protein -
GPY55_RS17370 1683857..1684003 - 147 WP_083135235.1 DUF3265 domain-containing protein -
GPY55_RS17375 1684021..1684841 - 821 Protein_1517 HNH endonuclease -
GPY55_RS17380 1685344..1685481 - 138 WP_140076720.1 DUF3265 domain-containing protein -
GPY55_RS17385 1685559..1686491 + 933 WP_083135234.1 DNA/RNA non-specific endonuclease -
GPY55_RS17390 1686501..1686977 + 477 WP_025611437.1 DUF600 family protein -
GPY55_RS17395 1687061..1687150 - 90 WP_083135237.1 DUF3265 domain-containing protein -
GPY55_RS17400 1687168..1687776 - 609 WP_083135233.1 hypothetical protein -
GPY55_RS17405 1687841..1687932 - 92 Protein_1523 DUF3265 domain-containing protein -
GPY55_RS17410 1687968..1688270 - 303 WP_010448451.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
GPY55_RS17415 1688258..1688515 - 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
GPY55_RS17420 1688597..1688686 - 90 WP_078235921.1 DUF3265 domain-containing protein -
GPY55_RS27135 1689207..1689374 - 168 WP_001883086.1 DUF3265 domain-containing protein -
GPY55_RS17435 1689754..1690572 - 819 WP_139794915.1 hypothetical protein -
GPY55_RS17440 1691771..1692202 - 432 WP_031847836.1 hypothetical protein -
GPY55_RS17445 1692236..1692346 - 111 WP_083135940.1 DUF3265 domain-containing protein -
GPY55_RS17450 1692353..1693019 - 667 Protein_1531 DUF4145 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vpadF / vxsC / virG / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscH / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscP / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 1205991..1726611 520620
- inside Integron - - 1671550..1825309 153759


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11625.52 Da        Isoelectric Point: 5.1765

>T145025 WP_010448451.1 NZ_CP046831:c1688270-1687968 [Vibrio parahaemolyticus]
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLGKQ

Download         Length: 303 bp

>T145025 NZ_CP062250:c1264731-1264624 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT145025 WP_005448240.1 NZ_CP046831:c1688515-1688258 [Vibrio parahaemolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp

>AT145025 NZ_CP062250:1264779-1264845 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K7SRN5

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References