Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 1294183..1294681 | Replicon | chromosome |
Accession | NZ_CP046804 | ||
Organism | Vibrio cidicii strain 2756-81 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A151JG87 |
Locus tag | GPY24_RS12090 | Protein ID | WP_000589153.1 |
Coordinates | 1294415..1294681 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A151JFU0 |
Locus tag | GPY24_RS12085 | Protein ID | WP_000643599.1 |
Coordinates | 1294183..1294428 (-) | Length | 82 a.a. |
Genomic Context
Location: 1289186..1289311 (126 bp)
Type: Others
Protein ID: WP_082796158.1
Type: Others
Protein ID: WP_082796158.1
Location: 1289293..1289772 (480 bp)
Type: Others
Protein ID: WP_065818787.1
Type: Others
Protein ID: WP_065818787.1
Location: 1289917..1290873 (957 bp)
Type: Others
Protein ID: WP_197467496.1
Type: Others
Protein ID: WP_197467496.1
Location: 1290930..1291463 (534 bp)
Type: Others
Protein ID: WP_065818788.1
Type: Others
Protein ID: WP_065818788.1
Location: 1291614..1292009 (396 bp)
Type: Others
Protein ID: WP_000870857.1
Type: Others
Protein ID: WP_000870857.1
Location: 1292165..1293040 (876 bp)
Type: Others
Protein ID: WP_065818789.1
Type: Others
Protein ID: WP_065818789.1
Location: 1293070..1293159 (90 bp)
Type: Others
Protein ID: WP_084834173.1
Type: Others
Protein ID: WP_084834173.1
Location: 1293176..1293574 (399 bp)
Type: Others
Protein ID: WP_156478402.1
Type: Others
Protein ID: WP_156478402.1
Location: 1293602..1293727 (126 bp)
Type: Others
Protein ID: Protein_1209
Type: Others
Protein ID: Protein_1209
Location: 1294183..1294428 (246 bp)
Type: Antitoxin
Protein ID: WP_000643599.1
Type: Antitoxin
Protein ID: WP_000643599.1
Location: 1294415..1294681 (267 bp)
Type: Toxin
Protein ID: WP_000589153.1
Type: Toxin
Protein ID: WP_000589153.1
Location: 1294858..1295322 (465 bp)
Type: Others
Protein ID: WP_158118642.1
Type: Others
Protein ID: WP_158118642.1
Location: 1295440..1295733 (294 bp)
Type: Others
Protein ID: WP_158118643.1
Type: Others
Protein ID: WP_158118643.1
Location: 1295721..1295813 (93 bp)
Type: Others
Protein ID: WP_156478403.1
Type: Others
Protein ID: WP_156478403.1
Location: 1295870..1296145 (276 bp)
Type: Others
Protein ID: WP_065819779.1
Type: Others
Protein ID: WP_065819779.1
Location: 1296185..1296334 (150 bp)
Type: Others
Protein ID: WP_080478972.1
Type: Others
Protein ID: WP_080478972.1
Location: 1296292..1296576 (285 bp)
Type: Others
Protein ID: Protein_1217
Type: Others
Protein ID: Protein_1217
Location: 1296696..1297397 (702 bp)
Type: Others
Protein ID: WP_197467433.1
Type: Others
Protein ID: WP_197467433.1
Location: 1297408..1298940 (1533 bp)
Type: Others
Protein ID: WP_065818814.1
Type: Others
Protein ID: WP_065818814.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPY24_RS12040 | 1289186..1289311 | - | 126 | WP_082796158.1 | DUF3265 domain-containing protein | - |
GPY24_RS12045 | 1289293..1289772 | - | 480 | WP_065818787.1 | GNAT family N-acetyltransferase | - |
GPY24_RS12050 | 1289917..1290873 | - | 957 | WP_197467496.1 | hypothetical protein | - |
GPY24_RS12055 | 1290930..1291463 | - | 534 | WP_065818788.1 | GNAT family N-acetyltransferase | - |
GPY24_RS12060 | 1291614..1292009 | - | 396 | WP_000870857.1 | DUF3465 domain-containing protein | - |
GPY24_RS12065 | 1292165..1293040 | - | 876 | WP_065818789.1 | hypothetical protein | - |
GPY24_RS12070 | 1293070..1293159 | - | 90 | WP_084834173.1 | DUF3265 domain-containing protein | - |
GPY24_RS12075 | 1293176..1293574 | - | 399 | WP_156478402.1 | hypothetical protein | - |
GPY24_RS12080 | 1293602..1293727 | - | 126 | Protein_1209 | DUF3265 domain-containing protein | - |
GPY24_RS12085 | 1294183..1294428 | - | 246 | WP_000643599.1 | hypothetical protein | Antitoxin |
GPY24_RS12090 | 1294415..1294681 | - | 267 | WP_000589153.1 | BrnT family toxin | Toxin |
GPY24_RS12095 | 1294858..1295322 | - | 465 | WP_158118642.1 | hypothetical protein | - |
GPY24_RS12100 | 1295440..1295733 | - | 294 | WP_158118643.1 | hypothetical protein | - |
GPY24_RS12105 | 1295721..1295813 | - | 93 | WP_156478403.1 | acetyltransferase | - |
GPY24_RS12110 | 1295870..1296145 | - | 276 | WP_065819779.1 | hypothetical protein | - |
GPY24_RS12115 | 1296185..1296334 | - | 150 | WP_080478972.1 | DUF3265 domain-containing protein | - |
GPY24_RS12120 | 1296292..1296576 | - | 285 | Protein_1217 | DUF2971 domain-containing protein | - |
GPY24_RS12125 | 1296696..1297397 | - | 702 | WP_197467433.1 | IS21-like element helper ATPase IstB | - |
GPY24_RS12130 | 1297408..1298940 | - | 1533 | WP_065818814.1 | IS21 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 1287888..1315231 | 27343 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10062.32 Da Isoelectric Point: 7.3171
>T144962 WP_000589153.1 NZ_CP046804:c1294681-1294415 [Vibrio cidicii]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGANIRIISVRRSRKA
EVSLYESA
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGANIRIISVRRSRKA
EVSLYESA
Download Length: 267 bp
>T144962 NZ_CP062247:c3694650-3694543 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 82 a.a. Molecular weight: 9504.80 Da Isoelectric Point: 6.2241
>AT144962 WP_000643599.1 NZ_CP046804:c1294428-1294183 [Vibrio cidicii]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMYKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMYKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R
Download Length: 246 bp
>AT144962 NZ_CP062247:3694699-3694765 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JG87 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151JFU0 |