Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1884478..1885023 Replicon chromosome
Accession NZ_CP046791
Organism Vibrio navarrensis strain 2462-79

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag GPY30_RS09105 Protein ID WP_158133653.1
Coordinates 1884727..1885023 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag GPY30_RS09100 Protein ID WP_158133652.1
Coordinates 1884478..1884720 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GPY30_RS09050 1879715..1880140 - 426 WP_001894008.1 hypothetical protein -
GPY30_RS09055 1880250..1880385 - 136 Protein_1732 DUF3265 domain-containing protein -
GPY30_RS09060 1880737..1880847 - 111 WP_082796215.1 DUF3265 domain-containing protein -
GPY30_RS09065 1880892..1881197 - 306 WP_061897568.1 hypothetical protein -
GPY30_RS09070 1881231..1881356 - 126 WP_001891271.1 DUF3265 domain-containing protein -
GPY30_RS09075 1882720..1882845 - 126 WP_071919811.1 DUF3265 domain-containing protein -
GPY30_RS09080 1883188..1883310 - 123 WP_158133650.1 DUF3265 domain-containing protein -
GPY30_RS09085 1883295..1883771 - 477 WP_158133651.1 GNAT family N-acetyltransferase -
GPY30_RS09090 1883805..1883930 - 126 WP_080284520.1 DUF3265 domain-containing protein -
GPY30_RS09095 1884262..1884351 - 90 WP_114708545.1 DUF3265 domain-containing protein -
GPY30_RS09100 1884478..1884720 + 243 WP_158133652.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
GPY30_RS09105 1884727..1885023 + 297 WP_158133653.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
GPY30_RS09110 1885080..1885205 - 126 WP_081946578.1 DUF3265 domain-containing protein -
GPY30_RS09115 1885656..1886429 - 774 WP_041051862.1 NERD domain-containing protein -
GPY30_RS09120 1886458..1886589 - 132 WP_158133654.1 DUF3265 domain-containing protein -
GPY30_RS09125 1886570..1887013 - 444 WP_158133655.1 hypothetical protein -
GPY30_RS09130 1887041..1887154 - 114 Protein_1747 DUF3265 domain-containing protein -
GPY30_RS09135 1887148..1888218 - 1071 WP_094132855.1 hypothetical protein -
GPY30_RS09140 1888263..1888384 - 122 Protein_1749 DUF3265 domain-containing protein -
GPY30_RS09145 1888744..1888854 - 111 WP_080284294.1 DUF3265 domain-containing protein -
GPY30_RS09150 1889197..1889292 - 96 WP_158133656.1 DUF3265 domain-containing protein -
GPY30_RS09155 1889321..1889728 - 408 WP_158135000.1 hypothetical protein -
GPY30_RS09160 1889747..1889833 - 87 Protein_1753 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - VP1611 / katB 1589386..2075475 486089
- inside Integron - - 1759479..1890842 131363


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-59)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11326.04 Da        Isoelectric Point: 9.7800

>T144945 WP_158133653.1 NZ_CP046791:1884727-1885023 [Vibrio navarrensis]
MQKNKYKLSKLAQAHLRKIKSYTVNNFSEMQWRSYKDTLLTGFQMLADNPAVGRSCDEIYPNGFYFPVGKHTAYFTKEDG
FILVVAVLGQSQLPQYHL

Download         Length: 297 bp

>T144945 NZ_CP062247:c1266469-1266362 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8987.16 Da        Isoelectric Point: 4.5720

>AT144945 WP_158133652.1 NZ_CP046791:1884478-1884720 [Vibrio navarrensis]
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDAVVVMSIKDYEELDAMKTDYLRYCFESAKQDLAQGSVVDGEDFLNAL

Download         Length: 243 bp

>AT144945 NZ_CP062247:1266516-1266582 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References