Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 2089361..2089908 | Replicon | chromosome |
| Accession | NZ_CP046772 | ||
| Organism | Vibrio alginolyticus strain 2014V-1011 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | GPY59_RS18305 | Protein ID | WP_015296906.1 |
| Coordinates | 2089361..2089663 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A7Y3ZEQ4 |
| Locus tag | GPY59_RS18310 | Protein ID | WP_015296907.1 |
| Coordinates | 2089651..2089908 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPY59_RS18255 | 2084442..2084531 | - | 90 | WP_080619587.1 | DUF3265 domain-containing protein | - |
| GPY59_RS18260 | 2084556..2084891 | - | 336 | WP_158173982.1 | TonB family protein | - |
| GPY59_RS18265 | 2085046..2085429 | - | 384 | WP_158173983.1 | hypothetical protein | - |
| GPY59_RS18270 | 2085592..2086134 | - | 543 | WP_158173984.1 | hypothetical protein | - |
| GPY59_RS18275 | 2086163..2086252 | - | 90 | WP_072609598.1 | DUF3265 domain-containing protein | - |
| GPY59_RS26120 | 2086279..2086866 | - | 588 | WP_180926727.1 | hypothetical protein | - |
| GPY59_RS18280 | 2086912..2087004 | - | 93 | WP_115386419.1 | DUF3265 domain-containing protein | - |
| GPY59_RS18285 | 2087079..2087324 | + | 246 | WP_038140558.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| GPY59_RS18290 | 2087324..2087641 | + | 318 | WP_095482530.1 | CcdB family protein | - |
| GPY59_RS18295 | 2088623..2088712 | - | 90 | WP_079390649.1 | DUF3265 domain-containing protein | - |
| GPY59_RS26125 | 2088959..2089108 | - | 150 | WP_199266769.1 | hypothetical protein | - |
| GPY59_RS18300 | 2089233..2089325 | - | 93 | WP_079858050.1 | DUF3265 domain-containing protein | - |
| GPY59_RS18305 | 2089361..2089663 | - | 303 | WP_015296906.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| GPY59_RS18310 | 2089651..2089908 | - | 258 | WP_015296907.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| GPY59_RS18315 | 2089990..2090118 | - | 129 | WP_158173985.1 | DUF3265 domain-containing protein | - |
| GPY59_RS18320 | 2090097..2090642 | - | 546 | WP_136976250.1 | GNAT family N-acetyltransferase | - |
| GPY59_RS18325 | 2090789..2091328 | - | 540 | WP_158173986.1 | hypothetical protein | - |
| GPY59_RS26130 | 2091356..2091445 | - | 90 | WP_079854214.1 | DUF3265 domain-containing protein | - |
| GPY59_RS18335 | 2091474..2091881 | - | 408 | WP_158173988.1 | hypothetical protein | - |
| GPY59_RS18340 | 2092321..2092431 | - | 111 | WP_158174251.1 | DUF3265 domain-containing protein | - |
| GPY59_RS18345 | 2092428..2092874 | - | 447 | WP_158173989.1 | GNAT family N-acetyltransferase | - |
| GPY59_RS18350 | 2093019..2093426 | - | 408 | WP_132937075.1 | hypothetical protein | - |
| GPY59_RS18355 | 2093453..2093569 | - | 117 | WP_080996729.1 | DUF3265 domain-containing protein | - |
| GPY59_RS18360 | 2093560..2093871 | - | 312 | WP_053304462.1 | antibiotic biosynthesis monooxygenase | - |
| GPY59_RS18365 | 2094015..2094404 | - | 390 | WP_158173976.1 | hypothetical protein | - |
| GPY59_RS18370 | 2094436..2094528 | - | 93 | WP_078513198.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2025588..2131457 | 105869 | |
| - | inside | Integron | - | - | 2034766..2130339 | 95573 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11727.61 Da Isoelectric Point: 4.8838
>T144919 WP_015296906.1 NZ_CP046772:c2089663-2089361 [Vibrio alginolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDDDKV
FILFVMRAERDLRKFLLSKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDDDKV
FILFVMRAERDLRKFLLSKQ
Download Length: 303 bp
>T144919 NZ_CP062246:c1265801-1265694 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 86 a.a. Molecular weight: 9638.16 Da Isoelectric Point: 6.7269
>AT144919 WP_015296907.1 NZ_CP046772:c2089908-2089651 [Vibrio alginolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKMVSHDEAKDKM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKMVSHDEAKDKM
SKWLK
Download Length: 258 bp
>AT144919 NZ_CP062246:1265848-1265914 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|