Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
Location | 3305486..3306002 | Replicon | chromosome |
Accession | NZ_CP046763 | ||
Organism | Vibrio parahaemolyticus strain 2012AW-0353 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | GPY19_RS16545 | Protein ID | WP_031778247.1 |
Coordinates | 3305486..3305755 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A7W4CB60 |
Locus tag | GPY19_RS16550 | Protein ID | WP_005483180.1 |
Coordinates | 3305748..3306002 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPY19_RS16500 | 3301009..3301332 | - | 324 | WP_154119766.1 | hypothetical protein | - |
GPY19_RS16505 | 3301375..3301467 | - | 93 | WP_154119768.1 | DUF3265 domain-containing protein | - |
GPY19_RS16510 | 3301513..3302037 | - | 525 | WP_154119770.1 | AAA family ATPase | - |
GPY19_RS16515 | 3302082..3302216 | - | 135 | WP_154120037.1 | DUF3265 domain-containing protein | - |
GPY19_RS16520 | 3302213..3302596 | - | 384 | WP_154119772.1 | GFA family protein | - |
GPY19_RS16525 | 3303230..3303733 | - | 504 | WP_154119774.1 | hypothetical protein | - |
GPY19_RS16530 | 3303730..3303897 | - | 168 | WP_195723295.1 | DUF3265 domain-containing protein | - |
GPY19_RS16535 | 3303867..3304490 | - | 624 | WP_154119776.1 | hypothetical protein | - |
GPY19_RS16540 | 3304628..3305323 | - | 696 | WP_154119778.1 | hypothetical protein | - |
GPY19_RS16545 | 3305486..3305755 | - | 270 | WP_031778247.1 | Txe/YoeB family addiction module toxin | Toxin |
GPY19_RS16550 | 3305748..3306002 | - | 255 | WP_005483180.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
GPY19_RS16555 | 3306105..3306197 | - | 93 | WP_076664760.1 | DUF3265 domain-containing protein | - |
GPY19_RS16560 | 3306223..3306924 | - | 702 | WP_158131209.1 | hypothetical protein | - |
GPY19_RS16565 | 3307086..3307457 | - | 372 | WP_072611945.1 | hypothetical protein | - |
GPY19_RS16570 | 3307504..3307593 | - | 90 | WP_079750700.1 | DUF3265 domain-containing protein | - |
GPY19_RS16575 | 3307622..3308329 | - | 708 | WP_138937910.1 | hypothetical protein | - |
GPY19_RS16580 | 3308357..3308482 | - | 126 | WP_080256126.1 | DUF3265 domain-containing protein | - |
GPY19_RS16585 | 3308810..3308938 | - | 129 | WP_158131216.1 | DUF3265 domain-containing protein | - |
GPY19_RS16590 | 3309488..3309919 | - | 432 | WP_017049022.1 | GNAT family N-acetyltransferase | - |
GPY19_RS16595 | 3310127..3310453 | - | 327 | WP_031778052.1 | hypothetical protein | - |
GPY19_RS16600 | 3310501..3310593 | - | 93 | WP_005445235.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 3197020..3317093 | 120073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10641.04 Da Isoelectric Point: 7.9816
>T144917 WP_031778247.1 NZ_CP046763:c3305755-3305486 [Vibrio parahaemolyticus]
MSSSQRLLLWTDDAWDDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDQAI
TIISCRYHY
MSSSQRLLLWTDDAWDDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDQAI
TIISCRYHY
Download Length: 270 bp
>T144917 NZ_CP062246:c1264731-1264624 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 85 a.a. Molecular weight: 9481.66 Da Isoelectric Point: 5.0623
>AT144917 WP_005483180.1 NZ_CP046763:c3306002-3305748 [Vibrio parahaemolyticus]
MRIVSFTEARNGLKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNVEHLNRSIAQYRAGKTTARE
LIDE
MRIVSFTEARNGLKAVLDGVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPQNVEHLNRSIAQYRAGKTTARE
LIDE
Download Length: 255 bp
>AT144917 NZ_CP062246:1264779-1264845 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|