Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1004584..1005143 | Replicon | chromosome |
Accession | NZ_CP046738 | ||
Organism | Vibrio cholerae strain 2015V-1126 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | GPW74_RS17680 | Protein ID | WP_123012084.1 |
Coordinates | 1004865..1005143 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9L991 |
Locus tag | GPW74_RS17675 | Protein ID | WP_000381183.1 |
Coordinates | 1004584..1004868 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPW74_RS17630 | 999694..999855 | - | 162 | WP_123012082.1 | DUF3709 domain-containing protein | - |
GPW74_RS17635 | 999836..999928 | - | 93 | WP_080368416.1 | DUF3265 domain-containing protein | - |
GPW74_RS18740 | 999955..1000272 | - | 318 | WP_154401610.1 | hypothetical protein | - |
GPW74_RS17640 | 1000286..1000363 | - | 78 | Protein_867 | DUF3265 domain-containing protein | - |
GPW74_RS17645 | 1000474..1001304 | + | 831 | WP_000582685.1 | hypothetical protein | - |
GPW74_RS18745 | 1001317..1001478 | + | 162 | WP_184478423.1 | hypothetical protein | - |
GPW74_RS17650 | 1001770..1002093 | - | 324 | WP_123012139.1 | DUF3709 domain-containing protein | - |
GPW74_RS17660 | 1002279..1002719 | - | 441 | WP_001966102.1 | DUF1311 domain-containing protein | - |
GPW74_RS17665 | 1002872..1003339 | - | 468 | WP_000702485.1 | GNAT family N-acetyltransferase | - |
GPW74_RS17675 | 1004584..1004868 | + | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
GPW74_RS17680 | 1004865..1005143 | + | 279 | WP_123012084.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GPW74_RS17685 | 1005302..1005718 | - | 417 | WP_000759008.1 | DUF1311 domain-containing protein | - |
GPW74_RS17690 | 1005871..1006122 | - | 252 | WP_123012140.1 | TIGR03643 family protein | - |
GPW74_RS18750 | 1006378..1006548 | - | 171 | WP_000934881.1 | DUF645 family protein | - |
GPW74_RS17705 | 1006864..1007502 | - | 639 | WP_114743462.1 | hypothetical protein | - |
GPW74_RS17710 | 1007529..1007621 | - | 93 | WP_080368416.1 | DUF3265 domain-containing protein | - |
GPW74_RS17715 | 1007648..1007986 | - | 339 | WP_000196674.1 | hypothetical protein | - |
GPW74_RS18755 | 1008166..1008204 | - | 39 | WP_082798268.1 | hypothetical protein | - |
GPW74_RS18760 | 1008258..1008401 | - | 144 | Protein_882 | DUF645 family protein | - |
GPW74_RS17725 | 1008786..1008996 | - | 211 | Protein_883 | DUF3709 domain-containing protein | - |
GPW74_RS17730 | 1009032..1009157 | - | 126 | WP_123012141.1 | DUF3709 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 949375..1072270 | 122895 | |
- | inside | Genomic island | blaCARB-7 | - | 949582..1075528 | 125946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10866.57 Da Isoelectric Point: 4.6794
>T144838 WP_123012084.1 NZ_CP046738:1004865-1005143 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAEKTDELIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQRQKFPND
MIFWEEASLNDREKIFEFLYDFNPAAAEKTDELIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQRQKFPND
Download Length: 279 bp
>T144838 NZ_CP062243:c1265801-1265694 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10901.25 Da Isoelectric Point: 8.0775
>AT144838 WP_000381183.1 NZ_CP046738:1004584-1004868 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA
Download Length: 285 bp
>AT144838 NZ_CP062243:1265848-1265914 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|