Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 222964..223600 | Replicon | chromosome |
Accession | NZ_CP046266 | ||
Organism | Bacillus sp. DSL-17 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0M2PN83 |
Locus tag | GMB29_RS01220 | Protein ID | WP_026562078.1 |
Coordinates | 223250..223600 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | GMB29_RS01215 | Protein ID | WP_136358446.1 |
Coordinates | 222964..223245 (+) | Length | 94 a.a. |
Genomic Context
Location: 219358..219720 (363 bp)
Type: Others
Protein ID: WP_136358452.1
Type: Others
Protein ID: WP_136358452.1
Location: 220064..221086 (1023 bp)
Type: Others
Protein ID: WP_136358450.1
Type: Others
Protein ID: WP_136358450.1
Location: 221430..222599 (1170 bp)
Type: Others
Protein ID: WP_136358448.1
Type: Others
Protein ID: WP_136358448.1
Location: 222964..223245 (282 bp)
Type: Antitoxin
Protein ID: WP_136358446.1
Type: Antitoxin
Protein ID: WP_136358446.1
Location: 223250..223600 (351 bp)
Type: Toxin
Protein ID: WP_026562078.1
Type: Toxin
Protein ID: WP_026562078.1
Location: 223737..224567 (831 bp)
Type: Others
Protein ID: WP_136358444.1
Type: Others
Protein ID: WP_136358444.1
Location: 224571..224933 (363 bp)
Type: Others
Protein ID: WP_136358442.1
Type: Others
Protein ID: WP_136358442.1
Location: 224937..225338 (402 bp)
Type: Others
Protein ID: WP_136358440.1
Type: Others
Protein ID: WP_136358440.1
Location: 225348..226355 (1008 bp)
Type: Others
Protein ID: WP_136358438.1
Type: Others
Protein ID: WP_136358438.1
Location: 226412..226744 (333 bp)
Type: Others
Protein ID: WP_136358436.1
Type: Others
Protein ID: WP_136358436.1
Location: 226741..227223 (483 bp)
Type: Others
Protein ID: WP_136358434.1
Type: Others
Protein ID: WP_136358434.1
Location: 227189..227980 (792 bp)
Type: Others
Protein ID: WP_136358432.1
Type: Others
Protein ID: WP_136358432.1
Location: 227977..228576 (600 bp)
Type: Others
Protein ID: WP_136358430.1
Type: Others
Protein ID: WP_136358430.1
Location: 218475..219197 (723 bp)
Type: Others
Protein ID: WP_136358454.1
Type: Others
Protein ID: WP_136358454.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GMB29_RS01195 | 218475..219197 | - | 723 | WP_136358454.1 | rhomboid family intramembrane serine protease | - |
GMB29_RS01200 | 219358..219720 | + | 363 | WP_136358452.1 | holo-ACP synthase | - |
GMB29_RS01205 | 220064..221086 | + | 1023 | WP_136358450.1 | outer membrane lipoprotein carrier protein LolA | - |
GMB29_RS01210 | 221430..222599 | + | 1170 | WP_136358448.1 | alanine racemase | - |
GMB29_RS01215 | 222964..223245 | + | 282 | WP_136358446.1 | antitoxin endoai | Antitoxin |
GMB29_RS01220 | 223250..223600 | + | 351 | WP_026562078.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
GMB29_RS01225 | 223737..224567 | + | 831 | WP_136358444.1 | STAS domain-containing protein | - |
GMB29_RS01230 | 224571..224933 | + | 363 | WP_136358442.1 | STAS domain-containing protein | - |
GMB29_RS01235 | 224937..225338 | + | 402 | WP_136358440.1 | anti-sigma regulatory factor | - |
GMB29_RS01240 | 225348..226355 | + | 1008 | WP_136358438.1 | PP2C family protein-serine/threonine phosphatase | - |
GMB29_RS01245 | 226412..226744 | + | 333 | WP_136358436.1 | anti-sigma factor antagonist | - |
GMB29_RS01250 | 226741..227223 | + | 483 | WP_136358434.1 | anti-sigma B factor RsbW | - |
GMB29_RS01255 | 227189..227980 | + | 792 | WP_136358432.1 | RNA polymerase sigma factor SigB | - |
GMB29_RS01260 | 227977..228576 | + | 600 | WP_136358430.1 | SpoIIE family protein phosphatase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13020.06 Da Isoelectric Point: 4.8781
>T143787 WP_026562078.1 NZ_CP046266:223250-223600 [Bacillus sp. DSL-17]
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
>T143787 NZ_CP061367:c3559985-3559882 [Shigella sonnei]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTTTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTTTTTTT
Antitoxin
Download Length: 94 a.a. Molecular weight: 10559.02 Da Isoelectric Point: 5.1783
>AT143787 WP_136358446.1 NZ_CP046266:222964-223245 [Bacillus sp. DSL-17]
VSESSATTEILIQLPQALVSELDGLVKQENGNRNELIYQATKMYIRERKMRQIRESMRRGYMEMAKINLNIASEAFLAES
EADHTVERLVSGG
VSESSATTEILIQLPQALVSELDGLVKQENGNRNELIYQATKMYIRERKMRQIRESMRRGYMEMAKINLNIASEAFLAES
EADHTVERLVSGG
Download Length: 282 bp
>AT143787 NZ_CP061367:3559881-3560115 [Shigella sonnei]
TAAAAAAAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCA
TTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAAT
AAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCGTTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
TAAAAAAAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCA
TTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAAT
AAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCGTTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2PN83 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |