Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 68786..69429 | Replicon | plasmid p1916D18-2 |
Accession | NZ_CP045999 | ||
Organism | Escherichia coli strain 1916D18 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | GJD92_RS00645 | Protein ID | WP_063073410.1 |
Coordinates | 68786..69202 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A3Q0N5I0 |
Locus tag | GJD92_RS00650 | Protein ID | WP_063073411.1 |
Coordinates | 69199..69429 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GJD92_RS00615 | 64038..64691 | + | 654 | Protein_53 | IS21-like element IS21 family transposase | - |
GJD92_RS00620 | 64691..65475 | + | 785 | Protein_54 | ATP-binding protein | - |
GJD92_RS00625 | 65534..65629 | - | 96 | Protein_55 | VapC toxin family PIN domain ribonuclease | - |
GJD92_RS00630 | 65626..65856 | - | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
GJD92_RS00635 | 66143..67165 | - | 1023 | WP_063073408.1 | hypothetical protein | - |
GJD92_RS00640 | 67150..68712 | - | 1563 | WP_063073409.1 | AAA family ATPase | - |
GJD92_RS00645 | 68786..69202 | - | 417 | WP_063073410.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
GJD92_RS00650 | 69199..69429 | - | 231 | WP_063073411.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
GJD92_RS23875 | 69386..69565 | + | 180 | Protein_61 | hypothetical protein | - |
GJD92_RS00655 | 69709..70413 | - | 705 | WP_154139461.1 | IS6 family transposase | - |
GJD92_RS00660 | 70479..70910 | + | 432 | WP_001707302.1 | hypothetical protein | - |
GJD92_RS00665 | 70907..71698 | + | 792 | WP_000016494.1 | site-specific integrase | - |
GJD92_RS00670 | 71850..72125 | - | 276 | WP_050858693.1 | hypothetical protein | - |
GJD92_RS00675 | 72119..72763 | - | 645 | WP_000633913.1 | AAA family ATPase | - |
GJD92_RS00680 | 72992..73963 | + | 972 | WP_001103690.1 | hypothetical protein | - |
GJD92_RS00685 | 73968..74360 | + | 393 | WP_063073471.1 | plasmid partitioning/stability family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(A) | - | 1..78498 | 78498 | |
- | inside | IScluster/Tn | - | - | 61705..70413 | 8708 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15167.53 Da Isoelectric Point: 7.8882
>T143269 WP_063073410.1 NZ_CP045999:c69202-68786 [Escherichia coli]
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCTRLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHSIAAGAVLVTNNTREFERVPGLVLEDWIR
VNKTYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCTRLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHSIAAGAVLVTNNTREFERVPGLVLEDWIR
Download Length: 417 bp
>T143269 NZ_CP060981:61462-61614 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8688.84 Da Isoelectric Point: 4.6310
>AT143269 WP_063073411.1 NZ_CP045999:c69429-69199 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAKLEKADPDFMAEREDVVTDEGRVNL
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAKLEKADPDFMAEREDVVTDEGRVNL
Download Length: 231 bp
>AT143269 NZ_CP060981:c61412-61350 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|