Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 197704..198229 | Replicon | plasmid pAUSMDU00010535_01 |
Accession | NZ_CP045942 | ||
Organism | Shigella flexneri 2a strain AUSMDU00010535 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | Q326Z8 |
Locus tag | GJE14_RS24845 | Protein ID | WP_001159860.1 |
Coordinates | 197924..198229 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | Q7BEK0 |
Locus tag | GJE14_RS24840 | Protein ID | WP_000813626.1 |
Coordinates | 197704..197922 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GJE14_RS24805 (GJE14_24805) | 193430..193621 | + | 192 | Protein_228 | ATP-binding protein | - |
GJE14_RS24810 (GJE14_24810) | 193715..193924 | - | 210 | Protein_229 | peptidoglycan-binding protein | - |
GJE14_RS24815 (GJE14_24815) | 193974..194225 | - | 252 | WP_001381727.1 | transporter | - |
GJE14_RS24820 (GJE14_24820) | 194677..194961 | + | 285 | WP_011114774.1 | ribbon-helix-helix domain-containing protein | - |
GJE14_RS24825 (GJE14_24825) | 194961..195236 | + | 276 | WP_000421262.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GJE14_RS24835 (GJE14_24835) | 196215..197168 | + | 954 | Protein_234 | IS66 family transposase | - |
GJE14_RS24840 (GJE14_24840) | 197704..197922 | + | 219 | WP_000813626.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
GJE14_RS24845 (GJE14_24845) | 197924..198229 | + | 306 | WP_001159860.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
GJE14_RS24855 (GJE14_24855) | 198622..200259 | + | 1638 | WP_000936806.1 | T3SS effector E3 ubiquitin-protein ligase IpaH9.8 | - |
GJE14_RS24860 (GJE14_24860) | 200467..200736 | + | 270 | Protein_238 | type II toxin-antitoxin system antitoxin YacA | - |
GJE14_RS26510 | 200736..200905 | + | 170 | Protein_239 | type II toxin-antitoxin system toxin YacB | - |
GJE14_RS24865 (GJE14_24865) | 200988..201578 | + | 591 | WP_000705601.1 | type III secretion system effector protein kinase OspG | - |
GJE14_RS25915 | 201935..202201 | + | 267 | Protein_241 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ipaH1.4 / ospE2 / nleE / icsP/sopA / ospB / ospC3 / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 / ipaH4.5 / ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG | 1..234182 | 234182 | |
- | inside | IScluster/Tn | - | ospI / ipaH9.8 / ospG | 182928..207068 | 24140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11736.59 Da Isoelectric Point: 6.4674
>T143087 WP_001159860.1 NZ_CP045942:197924-198229 [Shigella flexneri 2a]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
>T143087 NZ_CP060938:3327395-3327502 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 73 a.a. Molecular weight: 8333.36 Da Isoelectric Point: 6.2838
>AT143087 WP_000813626.1 NZ_CP045942:197704-197922 [Shigella flexneri 2a]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW
Download Length: 219 bp
>AT143087 NZ_CP060938:c3327348-3327282 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TTN3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q7BEK0 |