Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 194677..195236 Replicon plasmid pAUSMDU00010535_01
Accession NZ_CP045942
Organism Shigella flexneri 2a strain AUSMDU00010535

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag GJE14_RS24825 Protein ID WP_000421262.1
Coordinates 194961..195236 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A822PWA0
Locus tag GJE14_RS24820 Protein ID WP_011114774.1
Coordinates 194677..194961 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GJE14_RS24790 (GJE14_24790) 190602..191276 + 675 WP_004967157.1 IS66-like element accessory protein TnpA -
GJE14_RS24795 (GJE14_24795) 191273..191620 + 348 WP_000631708.1 IS66 family insertion sequence element accessory protein TnpB -
GJE14_RS24800 (GJE14_24800) 191640..193241 + 1602 WP_005063916.1 IS66-like element ISSfl3 family transposase -
GJE14_RS24805 (GJE14_24805) 193430..193621 + 192 Protein_228 ATP-binding protein -
GJE14_RS24810 (GJE14_24810) 193715..193924 - 210 Protein_229 peptidoglycan-binding protein -
GJE14_RS24815 (GJE14_24815) 193974..194225 - 252 WP_001381727.1 transporter -
GJE14_RS24820 (GJE14_24820) 194677..194961 + 285 WP_011114774.1 ribbon-helix-helix domain-containing protein Antitoxin
GJE14_RS24825 (GJE14_24825) 194961..195236 + 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
GJE14_RS24835 (GJE14_24835) 196215..197168 + 954 Protein_234 IS66 family transposase -
GJE14_RS24840 (GJE14_24840) 197704..197922 + 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
GJE14_RS24845 (GJE14_24845) 197924..198229 + 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ipaH1.4 / ospE2 / nleE / icsP/sopA / ospB / ospC3 / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospC2 / ipaH7.8 / ipaH4.5 / ospD3/senA / ospC1 / ospC3 / ipaJ / ipaA / ipaD / ipaC / ipaB / ipgC / ipgB1 / ipgA / icsB / ipgD / ipgE / ipgF / mxiG / mxiH / mxiI / mxiJ / mxiK / mxiN / mxiL / mxiM / mxiE / mxiD / mxiC / mxiA / spa15 / spa47 / spa13 / spa32 / spa33 / spa24 / spa9 / spa29 / spa40 / virA / icsA/virG / papC / ospI / ipaH9.8 / ospG 1..234182 234182
- inside IScluster/Tn - ospI / ipaH9.8 / ospG 182928..207068 24140


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T143086 WP_000421262.1 NZ_CP045942:194961-195236 [Shigella flexneri 2a]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

>T143086 NZ_CP060938:3326860-3326967 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10529.97 Da        Isoelectric Point: 6.2150

>AT143086 WP_011114774.1 NZ_CP045942:194677-194961 [Shigella flexneri 2a]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHLLPVPR

Download         Length: 285 bp

>AT143086 NZ_CP060938:c3326813-3326747 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PVM3

Antitoxin

Source ID Structure
AlphaFold DB A0A822PWA0

References