Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TsxAB/Xre(antitoxin) |
Location | 6836..7337 | Replicon | plasmid pAUSMDU00010534_03 |
Accession | NZ_CP045935 | ||
Organism | Shigella sonnei strain AUSMDU00010534 |
Toxin (Protein)
Gene name | TsxA | Uniprot ID | H1ZXU8 |
Locus tag | GJE15_RS25290 | Protein ID | WP_000702247.1 |
Coordinates | 6836..7096 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | TsxB | Uniprot ID | - |
Locus tag | GJE15_RS25295 | Protein ID | WP_001132407.1 |
Coordinates | 7086..7337 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GJE15_RS26355 | 2375..2527 | + | 153 | Protein_1 | DUF5431 family protein | - |
GJE15_RS25250 (GJE15_25250) | 2472..2594 | + | 123 | WP_223202818.1 | Hok/Gef family protein | - |
GJE15_RS25255 (GJE15_25255) | 2744..3340 | + | 597 | WP_000125164.1 | ProQ/FINO family protein | - |
GJE15_RS26360 | 3358..3642 | - | 285 | WP_001162371.1 | hypothetical protein | - |
GJE15_RS25265 (GJE15_25265) | 3716..4381 | - | 666 | WP_000532148.1 | division plane positioning ATPase MipZ | - |
GJE15_RS25270 (GJE15_25270) | 4980..5309 | + | 330 | WP_000855119.1 | hypothetical protein | - |
GJE15_RS26365 | 5417..5563 | - | 147 | WP_001356709.1 | hypothetical protein | - |
GJE15_RS25275 (GJE15_25275) | 5889..6212 | + | 324 | WP_000427402.1 | hypothetical protein | - |
GJE15_RS25280 (GJE15_25280) | 6253..6462 | + | 210 | WP_000866037.1 | hypothetical protein | - |
GJE15_RS25285 (GJE15_25285) | 6560..6784 | + | 225 | WP_000814384.1 | hypothetical protein | - |
GJE15_RS25290 (GJE15_25290) | 6836..7096 | + | 261 | WP_000702247.1 | hypothetical protein | Toxin |
GJE15_RS25295 (GJE15_25295) | 7086..7337 | + | 252 | WP_001132407.1 | transcriptional regulator | Antitoxin |
GJE15_RS25300 (GJE15_25300) | 7887..8165 | + | 279 | WP_135171922.1 | cobalamin biosynthesis protein CbiX | - |
GJE15_RS26370 | 8553..8996 | - | 444 | WP_000192626.1 | hypothetical protein | - |
GJE15_RS25310 (GJE15_25310) | 9293..9475 | + | 183 | WP_000833470.1 | type II toxin-antitoxin system HicA family toxin | - |
GJE15_RS25315 (GJE15_25315) | 9500..9937 | + | 438 | WP_000466318.1 | type II toxin-antitoxin system HicB family antitoxin | - |
GJE15_RS25320 (GJE15_25320) | 10068..10388 | - | 321 | WP_135171923.1 | hypothetical protein | - |
GJE15_RS25325 (GJE15_25325) | 10392..10679 | - | 288 | WP_000212745.1 | hypothetical protein | - |
GJE15_RS26375 | 11011..11133 | - | 123 | Protein_19 | hypothetical protein | - |
GJE15_RS25335 (GJE15_25335) | 11153..11752 | - | 600 | WP_000091423.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..57073 | 57073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 9817.29 Da Isoelectric Point: 10.0665
>T143062 WP_000702247.1 NZ_CP045935:6836-7096 [Shigella sonnei]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK
Download Length: 261 bp
>T143062 NZ_CP060933:3011384-3011491 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 84 a.a. Molecular weight: 9404.77 Da Isoelectric Point: 9.8120
>AT143062 WP_001132407.1 NZ_CP045935:7086-7337 [Shigella sonnei]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN
Download Length: 252 bp
>AT143062 NZ_CP060933:c3011336-3011269 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|