Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 976807..977441 | Replicon | chromosome |
Accession | NZ_CP045799 | ||
Organism | Pseudomonas syringae USA011 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N028_RS04520 | Protein ID | WP_024640186.1 |
Coordinates | 976807..977211 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A3M5LBD7 |
Locus tag | N028_RS04525 | Protein ID | WP_024640185.1 |
Coordinates | 977211..977441 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N028_RS04480 | 971819..972301 | + | 483 | WP_024640189.1 | PAS domain-containing protein | - |
N028_RS04485 | 972398..973654 | + | 1257 | WP_003404790.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
N028_RS04490 | 973802..974056 | + | 255 | WP_003404793.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
N028_RS04495 | 974053..974400 | + | 348 | WP_003404797.1 | type II toxin-antitoxin system ChpB family toxin | - |
N028_RS04500 | 974448..975110 | - | 663 | WP_003404800.1 | ChrR family anti-sigma-E factor | - |
N028_RS04505 | 975110..975622 | - | 513 | WP_003345995.1 | sigma-70 family RNA polymerase sigma factor | - |
N028_RS04510 | 975858..976046 | - | 189 | WP_024640188.1 | hypothetical protein | - |
N028_RS04515 | 976045..976620 | + | 576 | WP_024640187.1 | hypothetical protein | - |
N028_RS04520 | 976807..977211 | - | 405 | WP_024640186.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
N028_RS04525 | 977211..977441 | - | 231 | WP_024640185.1 | antitoxin | Antitoxin |
N028_RS04530 | 977558..978439 | - | 882 | WP_024640184.1 | aldose 1-epimerase | - |
N028_RS04535 | 978414..979385 | - | 972 | WP_024640183.1 | DMT family transporter | - |
N028_RS04540 | 979470..980750 | - | 1281 | WP_153795649.1 | TRAP transporter large permease | - |
N028_RS04545 | 980751..981278 | - | 528 | WP_003408544.1 | TRAP transporter small permease | - |
N028_RS04550 | 981341..982366 | - | 1026 | WP_024640181.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 967033..977441 | 10408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14872.13 Da Isoelectric Point: 6.4779
>T142602 WP_024640186.1 NZ_CP045799:c977211-976807 [Pseudomonas syringae USA011]
MLKYMLDTNICIFTIKNKPASVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTARLEVLPYDSDAAAHT
GMIRAELARAGTPIGPYDQMIAGHARSLGLVVITNNQREFQRVEGLRVEDWVSQ
MLKYMLDTNICIFTIKNKPASVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTARLEVLPYDSDAAAHT
GMIRAELARAGTPIGPYDQMIAGHARSLGLVVITNNQREFQRVEGLRVEDWVSQ
Download Length: 405 bp
>T142602 NZ_CP060748:2591328-2591435 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8535.55 Da Isoelectric Point: 4.7247
>AT142602 WP_024640185.1 NZ_CP045799:c977441-977211 [Pseudomonas syringae USA011]
MEQSTVFKSNRSQAVRLPKAVALPDDVKRVDVVAVGRTRIISPAGEMWNSWFDGENVSDDFMAERGQPAEQQRESL
MEQSTVFKSNRSQAVRLPKAVALPDDVKRVDVVAVGRTRIISPAGEMWNSWFDGENVSDDFMAERGQPAEQQRESL
Download Length: 231 bp
>AT142602 NZ_CP060748:c2591272-2591216 [Escherichia coli]
TCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
TCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|