Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3169918..3170549 | Replicon | chromosome |
Accession | NZ_CP045798 | ||
Organism | Thermoanaerosceptrum fracticalcis strain DRI-13 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | BR63_RS16150 | Protein ID | WP_034426056.1 |
Coordinates | 3170148..3170549 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A7G6E6F5 |
Locus tag | BR63_RS16145 | Protein ID | WP_034426058.1 |
Coordinates | 3169918..3170145 (+) | Length | 76 a.a. |
Genomic Context
Location: 3165598..3165909 (312 bp)
Type: Others
Protein ID: WP_051966310.1
Type: Others
Protein ID: WP_051966310.1
Location: 3166133..3167370 (1238 bp)
Type: Others
Protein ID: Protein_3152
Type: Others
Protein ID: Protein_3152
Location: 3168034..3168669 (636 bp)
Type: Others
Protein ID: Protein_3153
Type: Others
Protein ID: Protein_3153
Location: 3168719..3169024 (306 bp)
Type: Others
Protein ID: Protein_3154
Type: Others
Protein ID: Protein_3154
Location: 3169377..3169541 (165 bp)
Type: Others
Protein ID: WP_153802206.1
Type: Others
Protein ID: WP_153802206.1
Location: 3169918..3170145 (228 bp)
Type: Antitoxin
Protein ID: WP_034426058.1
Type: Antitoxin
Protein ID: WP_034426058.1
Location: 3170148..3170549 (402 bp)
Type: Toxin
Protein ID: WP_034426056.1
Type: Toxin
Protein ID: WP_034426056.1
Location: 3174470..3174571 (102 bp)
Type: Others
Protein ID: Protein_3161
Type: Others
Protein ID: Protein_3161
Location: 3175059..3175334 (276 bp)
Type: Others
Protein ID: WP_034424294.1
Type: Others
Protein ID: WP_034424294.1
Location: 3164963..3165280 (318 bp)
Type: Others
Protein ID: WP_034425938.1
Type: Others
Protein ID: WP_034425938.1
Location: 3170788..3171480 (693 bp)
Type: Others
Protein ID: WP_034426054.1
Type: Others
Protein ID: WP_034426054.1
Location: 3171687..3172019 (333 bp)
Type: Others
Protein ID: WP_207724815.1
Type: Others
Protein ID: WP_207724815.1
Location: 3172787..3174050 (1264 bp)
Type: Others
Protein ID: Protein_3160
Type: Others
Protein ID: Protein_3160
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BR63_RS16115 | 3164963..3165280 | - | 318 | WP_034425938.1 | hypothetical protein | - |
BR63_RS16120 | 3165598..3165909 | + | 312 | WP_051966310.1 | transposase | - |
BR63_RS16125 | 3166133..3167370 | + | 1238 | Protein_3152 | IS110 family transposase | - |
BR63_RS16130 | 3168034..3168669 | + | 636 | Protein_3153 | transposase | - |
BR63_RS16135 | 3168719..3169024 | + | 306 | Protein_3154 | transposase | - |
BR63_RS16140 | 3169377..3169541 | + | 165 | WP_153802206.1 | hypothetical protein | - |
BR63_RS16145 | 3169918..3170145 | + | 228 | WP_034426058.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
BR63_RS16150 | 3170148..3170549 | + | 402 | WP_034426056.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BR63_RS16155 | 3170788..3171480 | - | 693 | WP_034426054.1 | HNH endonuclease | - |
BR63_RS16160 | 3171687..3172019 | - | 333 | WP_207724815.1 | nucleotide-binding protein | - |
BR63_RS16165 | 3172787..3174050 | - | 1264 | Protein_3160 | IS3 family transposase | - |
BR63_RS16170 | 3174470..3174571 | + | 102 | Protein_3161 | hypothetical protein | - |
BR63_RS16175 | 3175059..3175334 | + | 276 | WP_034424294.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15057.75 Da Isoelectric Point: 9.3651
>T142601 WP_034426056.1 NZ_CP045798:3170148-3170549 [Thermoanaerosceptrum fracticalcis]
MRYMLDTNICIYIIKKKPVQVFQIFNALKVGDVCISSITLAELQYGVYKSQFPERNKLALVNFLAPITILPFSDRASVLY
GHIRAGLEKRGQIIGAYDLMIAAHALSEDLILVTNNTKEFSRIPNLPLKNWAE
MRYMLDTNICIYIIKKKPVQVFQIFNALKVGDVCISSITLAELQYGVYKSQFPERNKLALVNFLAPITILPFSDRASVLY
GHIRAGLEKRGQIIGAYDLMIAAHALSEDLILVTNNTKEFSRIPNLPLKNWAE
Download Length: 402 bp
>T142601 NZ_CP060748:2590793-2590900 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTAGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTAGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 76 a.a. Molecular weight: 8769.00 Da Isoelectric Point: 4.8146
>AT142601 WP_034426058.1 NZ_CP045798:3169918-3170145 [Thermoanaerosceptrum fracticalcis]
MDIAKIFFNGRSQAVRLPKEYRLEGSEVYVKKIDDVVLLIPKDSAWKTLESSLNYFSDDFMAERNQPEIEKREGL
MDIAKIFFNGRSQAVRLPKEYRLEGSEVYVKKIDDVVLLIPKDSAWKTLESSLNYFSDDFMAERNQPEIEKREGL
Download Length: 228 bp
>AT142601 NZ_CP060748:c2590737-2590681 [Escherichia coli]
TCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
TCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G6E6F5 |