Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3114809..3115426 | Replicon | chromosome |
Accession | NZ_CP045720 | ||
Organism | Pantoea eucalypti strain LMG 24197 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | E0LTU7 |
Locus tag | EE896_RS14615 | Protein ID | WP_003850458.1 |
Coordinates | 3115211..3115426 (+) | Length | 72 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | E0LTU8 |
Locus tag | EE896_RS14610 | Protein ID | WP_003850455.1 |
Coordinates | 3114809..3115186 (+) | Length | 126 a.a. |
Genomic Context
Location: 3111119..3111379 (261 bp)
Type: Others
Protein ID: WP_008924911.1
Type: Others
Protein ID: WP_008924911.1
Location: 3111383..3111523 (141 bp)
Type: Others
Protein ID: WP_003850445.1
Type: Others
Protein ID: WP_003850445.1
Location: 3114308..3114661 (354 bp)
Type: Others
Protein ID: WP_003850454.1
Type: Others
Protein ID: WP_003850454.1
Location: 3114809..3115186 (378 bp)
Type: Antitoxin
Protein ID: WP_003850455.1
Type: Antitoxin
Protein ID: WP_003850455.1
Location: 3115211..3115426 (216 bp)
Type: Toxin
Protein ID: WP_003850458.1
Type: Toxin
Protein ID: WP_003850458.1
Location: 3115846..3116163 (318 bp)
Type: Others
Protein ID: WP_039659087.1
Type: Others
Protein ID: WP_039659087.1
Location: 3116942..3117805 (864 bp)
Type: Others
Protein ID: WP_003850463.1
Type: Others
Protein ID: WP_003850463.1
Location: 3111569..3112447 (879 bp)
Type: Others
Protein ID: WP_003850447.1
Type: Others
Protein ID: WP_003850447.1
Location: 3112463..3113302 (840 bp)
Type: Others
Protein ID: WP_003850449.1
Type: Others
Protein ID: WP_003850449.1
Location: 3113299..3113967 (669 bp)
Type: Others
Protein ID: WP_008924910.1
Type: Others
Protein ID: WP_008924910.1
Location: 3116194..3116751 (558 bp)
Type: Others
Protein ID: WP_008924908.1
Type: Others
Protein ID: WP_008924908.1
Location: 3117855..3119141 (1287 bp)
Type: Others
Protein ID: WP_003850465.1
Type: Others
Protein ID: WP_003850465.1
Location: 3119176..3119514 (339 bp)
Type: Others
Protein ID: WP_003850469.1
Type: Others
Protein ID: WP_003850469.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EE896_RS14580 | 3111119..3111379 | + | 261 | WP_008924911.1 | type B 50S ribosomal protein L31 | - |
EE896_RS14585 | 3111383..3111523 | + | 141 | WP_003850445.1 | type B 50S ribosomal protein L36 | - |
EE896_RS14590 | 3111569..3112447 | - | 879 | WP_003850447.1 | metal ABC transporter substrate-binding protein | - |
EE896_RS14595 | 3112463..3113302 | - | 840 | WP_003850449.1 | metal ABC transporter permease | - |
EE896_RS14600 | 3113299..3113967 | - | 669 | WP_008924910.1 | ABC transporter ATP-binding protein | - |
EE896_RS14605 | 3114308..3114661 | + | 354 | WP_003850454.1 | hypothetical protein | - |
EE896_RS14610 | 3114809..3115186 | + | 378 | WP_003850455.1 | Hha toxicity modulator TomB | Antitoxin |
EE896_RS14615 | 3115211..3115426 | + | 216 | WP_003850458.1 | hemolysin expression modulator Hha | Toxin |
EE896_RS14625 | 3115846..3116163 | + | 318 | WP_039659087.1 | MGMT family protein | - |
EE896_RS14630 | 3116194..3116751 | - | 558 | WP_008924908.1 | YbaY family lipoprotein | - |
EE896_RS14635 | 3116942..3117805 | + | 864 | WP_003850463.1 | acyl-CoA thioesterase II | - |
EE896_RS14640 | 3117855..3119141 | - | 1287 | WP_003850465.1 | ammonium transporter AmtB | - |
EE896_RS14645 | 3119176..3119514 | - | 339 | WP_003850469.1 | P-II family nitrogen regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 72 a.a. Molecular weight: 8510.90 Da Isoelectric Point: 9.4825
>T142386 WP_003850458.1 NZ_CP045720:3115211-3115426 [Pantoea eucalypti]
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
MNKTLTKTDYLMRLRRCRSLDTLERVIEKNKYELPEDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR
Download Length: 216 bp
>T142386 NZ_CP060674:1568007-1568110 [Salmonella enterica]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 126 a.a. Molecular weight: 14636.25 Da Isoelectric Point: 4.3976
>AT142386 WP_003850455.1 NZ_CP045720:3114809-3115186 [Pantoea eucalypti]
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL
MDEYSPKRHDIAQLKYLCESLFDDSMATLTDSHHGWVNDPTSESNLQLNDLIEHIASFTMNYKIKHVEDEALISQIDEYL
DDTFMLFSNYGVNSPDLQRWQRSAKRLFNLFTEECAFLQQPSHSL
Download Length: 378 bp
>AT142386 NZ_CP060674:c1568112-1567967 [Salmonella enterica]
ATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTAAATCGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTGCG
ATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGC
ATTAATGCAGGCTAAATCGCCTTGCCCTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTTTGCG
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1I5AGC3 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1I5AG55 |