Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 48453..48987 | Replicon | plasmid pB1445CHC_150k |
Accession | NZ_CP045305 | ||
Organism | Legionella longbeachae strain B1445CHC |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7G4RL39 |
Locus tag | GCB94_RS00565 | Protein ID | WP_014845122.1 |
Coordinates | 48453..48734 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7G4RL40 |
Locus tag | GCB94_RS00570 | Protein ID | WP_014845121.1 |
Coordinates | 48727..48987 (-) | Length | 87 a.a. |
Genomic Context
Location: 43872..44195 (324 bp)
Type: Others
Protein ID: WP_014845127.1
Type: Others
Protein ID: WP_014845127.1
Location: 44248..45066 (819 bp)
Type: Others
Protein ID: WP_014845126.1
Type: Others
Protein ID: WP_014845126.1
Location: 45105..45458 (354 bp)
Type: Others
Protein ID: WP_014845125.1
Type: Others
Protein ID: WP_014845125.1
Location: 45436..45726 (291 bp)
Type: Others
Protein ID: WP_014845124.1
Type: Others
Protein ID: WP_014845124.1
Location: 45775..48273 (2499 bp)
Type: Others
Protein ID: WP_014845123.1
Type: Others
Protein ID: WP_014845123.1
Location: 49200..50084 (885 bp)
Type: Others
Protein ID: WP_014845120.1
Type: Others
Protein ID: WP_014845120.1
Location: 50190..50537 (348 bp)
Type: Others
Protein ID: WP_080031944.1
Type: Others
Protein ID: WP_080031944.1
Location: 50646..50879 (234 bp)
Type: Others
Protein ID: WP_014845118.1
Type: Others
Protein ID: WP_014845118.1
Location: 50866..51186 (321 bp)
Type: Others
Protein ID: WP_014845117.1
Type: Others
Protein ID: WP_014845117.1
Location: 53500..53655 (156 bp)
Type: Others
Protein ID: WP_154080667.1
Type: Others
Protein ID: WP_154080667.1
Location: 48453..48734 (282 bp)
Type: Toxin
Protein ID: WP_014845122.1
Type: Toxin
Protein ID: WP_014845122.1
Location: 48727..48987 (261 bp)
Type: Antitoxin
Protein ID: WP_014845121.1
Type: Antitoxin
Protein ID: WP_014845121.1
Location: 51624..52016 (393 bp)
Type: Others
Protein ID: Protein_55
Type: Others
Protein ID: Protein_55
Location: 52382..52915 (534 bp)
Type: Others
Protein ID: WP_061637559.1
Type: Others
Protein ID: WP_061637559.1
Location: 52937..53428 (492 bp)
Type: Others
Protein ID: WP_051009158.1
Type: Others
Protein ID: WP_051009158.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GCB94_RS00540 | 43872..44195 | + | 324 | WP_014845127.1 | hypothetical protein | - |
GCB94_RS00545 | 44248..45066 | + | 819 | WP_014845126.1 | hypothetical protein | - |
GCB94_RS00550 | 45105..45458 | + | 354 | WP_014845125.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
GCB94_RS00555 | 45436..45726 | + | 291 | WP_014845124.1 | helix-turn-helix domain-containing protein | - |
GCB94_RS00560 | 45775..48273 | + | 2499 | WP_014845123.1 | DEAD/DEAH box helicase family protein | - |
GCB94_RS00565 | 48453..48734 | - | 282 | WP_014845122.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
GCB94_RS00570 | 48727..48987 | - | 261 | WP_014845121.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
GCB94_RS00575 | 49200..50084 | + | 885 | WP_014845120.1 | recombinase family protein | - |
GCB94_RS00580 | 50190..50537 | + | 348 | WP_080031944.1 | WGR domain-containing protein | - |
GCB94_RS00585 | 50646..50879 | + | 234 | WP_014845118.1 | hypothetical protein | - |
GCB94_RS00590 | 50866..51186 | + | 321 | WP_014845117.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
GCB94_RS00595 | 51624..52016 | - | 393 | Protein_55 | methyltransferase domain-containing protein | - |
GCB94_RS00600 | 52382..52915 | - | 534 | WP_061637559.1 | IS91 family transposase | - |
GCB94_RS00605 | 52937..53428 | - | 492 | WP_051009158.1 | IS91 family transposase | - |
GCB94_RS00610 | 53500..53655 | + | 156 | WP_154080667.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaOXA-29 | - | 1..150426 | 150426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11028.69 Da Isoelectric Point: 8.9816
>T141690 WP_014845122.1 NZ_CP045305:c48734-48453 [Legionella longbeachae]
MLELELATQFKRDLKKITKQGKRRTLLDSIVEQLQKEEPLDPKHKDHSLSVNWDGYRECHITPDWLLIYKTIKDDRIQLL
RLSRTGSHSDLFG
MLELELATQFKRDLKKITKQGKRRTLLDSIVEQLQKEEPLDPKHKDHSLSVNWDGYRECHITPDWLLIYKTIKDDRIQLL
RLSRTGSHSDLFG
Download Length: 282 bp
>T141690 NZ_CP060065:196976-197083 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 87 a.a. Molecular weight: 9594.08 Da Isoelectric Point: 6.9803
>AT141690 WP_014845121.1 NZ_CP045305:c48987-48727 [Legionella longbeachae]
MNKAATINARIEPALKMQAEAILHKVGLSTAEAIRLFYSQVCLQNGLPFEVKIPNKETREAMAELESGKGERFKTMKDVW
DSVDNA
MNKAATINARIEPALKMQAEAILHKVGLSTAEAIRLFYSQVCLQNGLPFEVKIPNKETREAMAELESGKGERFKTMKDVW
DSVDNA
Download Length: 261 bp
>AT141690 NZ_CP060065:c196928-196862 [Escherichia coli]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G4RL39 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G4RL40 |