Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-CC2985
Location 54193..54727 Replicon plasmid pCD
Accession NZ_CP045147
Organism Yersinia pestis strain SCPM-O-B-6899 (231)

Toxin (Protein)


Gene name parE Uniprot ID Q663N8
Locus tag GCK69_RS22575 Protein ID WP_002213360.1
Coordinates 54428..54727 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID Q9ZGW3
Locus tag GCK69_RS22570 Protein ID WP_002224342.1
Coordinates 54193..54435 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GCK69_RS22550 50802..51968 + 1167 WP_002220902.1 plasmid-partitioning protein SopA -
GCK69_RS22555 51965..52930 + 966 WP_002213354.1 ParB/RepB/Spo0J family plasmid partition protein -
GCK69_RS22830 53090..53326 + 237 WP_154020274.1 hypothetical protein -
GCK69_RS23015 53475..53648 - 174 WP_002213357.1 hypothetical protein -
GCK69_RS22565 53735..54027 + 293 Protein_67 IS6 family transposase -
GCK69_RS22570 54193..54435 + 243 WP_002224342.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
GCK69_RS22575 54428..54727 + 300 WP_002213360.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
GCK69_RS22580 54867..55526 - 660 WP_002229754.1 type III secretion system effector GTPase activator YopE -
GCK69_RS22585 55720..56112 + 393 WP_002213403.1 type III secretion system chaperone SycE/YerA -
GCK69_RS22590 56175..56819 - 645 Protein_72 IS3 family transposase -
GCK69_RS22595 56922..58094 + 1173 WP_002220893.1 IS21 family transposase -
GCK69_RS22600 58094..58492 + 399 Protein_74 ATP-binding protein -
GCK69_RS22605 58869..59294 + 426 WP_002213267.1 type III secretion system chaperone SycH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - yopO/ypkA / yopJ/yopP / yopH / lcrQ/yscM / yscL / yscK / ylpB/yscJ / lcrO/yscI / yopR/yscH/lcrP / yscG / yscF / yscE / yscD / yscC / yscB / virG/yscW / yscU / yscT / yscS / yscR / yscQ / yscP / yscO / yscN / lcrE/yopN / tyeA / sycN / yscX / yscY / yscV/lcrD / lcrR / lcrG / lcrV / sycD/lcrH / yopB / yopD / yopM / sycT / yopT / yopK/yopQ / yopE / sycE/yerA / sycH / yadA / yadA 1..70303 70303


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

Antitoxin ParD

(5-72)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11632.19 Da        Isoelectric Point: 5.5114

>T141298 WP_002213360.1 NZ_CP045147:54428-54727 [Yersinia pestis]
VYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKNPELGAECNWICSDIRRFQYKKHGIYYITLSNDILI
SRVLHQSIDIDVQDFPEHE

Download         Length: 300 bp

>T141298 NZ_CP059917:c4619603-4619496 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8865.15 Da        Isoelectric Point: 6.4781

>AT141298 WP_002224342.1 NZ_CP045147:54193-54435 [Yersinia pestis]
MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSV

Download         Length: 243 bp

>AT141298 NZ_CP059917:4619660-4619718 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q663N8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E1NQY6

References