Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 2321138..2321666 Replicon chromosome
Accession NZ_CP044206
Organism Vibrio vulnificus strain Vv180806

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag F6X00_RS11020 Protein ID WP_005377002.1
Coordinates 2321138..2321428 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag F6X00_RS11025 Protein ID WP_005377003.1
Coordinates 2321418..2321666 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F6X00_RS10955 2316558..2316767 + 210 WP_182290874.1 DUF3265 domain-containing protein -
F6X00_RS10960 2316802..2317017 + 216 WP_017420689.1 DUF4177 domain-containing protein -
F6X00_RS10965 2317020..2317244 + 225 WP_038970033.1 membrane protein insertion efficiency factor YidD -
F6X00_RS10970 2317244..2317633 + 390 WP_039465690.1 hypothetical protein -
F6X00_RS10975 2317649..2317771 + 123 WP_182290876.1 DUF3265 domain-containing protein -
F6X00_RS10980 2317790..2318296 + 507 WP_182289670.1 hypothetical protein -
F6X00_RS10985 2318432..2318947 + 516 WP_182289672.1 GNAT family N-acetyltransferase -
F6X00_RS10990 2319029..2319076 + 48 Protein_2088 DUF3265 domain-containing protein -
F6X00_RS10995 2319511..2319879 + 369 WP_182289674.1 DUF4144 domain-containing protein -
F6X00_RS11000 2319912..2319983 + 72 WP_182290879.1 DUF3265 domain-containing protein -
F6X00_RS11005 2320035..2320499 + 465 WP_182289676.1 GNAT family N-acetyltransferase -
F6X00_RS11010 2320469..2320636 + 168 Protein_2092 DUF3265 domain-containing protein -
F6X00_RS11015 2320630..2321010 + 381 WP_029796920.1 hypothetical protein -
F6X00_RS11020 2321138..2321428 - 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
F6X00_RS11025 2321418..2321666 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
F6X00_RS11030 2321865..2322383 + 519 WP_011080315.1 GNAT family N-acetyltransferase -
F6X00_RS11035 2322544..2322864 + 321 WP_029797024.1 DUF2834 domain-containing protein -
F6X00_RS11040 2322801..2323031 + 231 WP_182290881.1 DUF3265 domain-containing protein -
F6X00_RS11045 2323001..2323417 + 417 WP_011150394.1 hypothetical protein -
F6X00_RS11050 2323414..2323524 + 111 WP_072611681.1 DUF3265 domain-containing protein -
F6X00_RS11055 2323885..2324478 + 594 WP_182290883.1 DUF3265 domain-containing protein -
F6X00_RS11060 2324574..2325047 + 474 WP_182289678.1 hypothetical protein -
F6X00_RS11065 2325025..2325204 + 180 WP_182289680.1 DUF3265 domain-containing protein -
F6X00_RS11070 2325197..2325646 + 450 WP_182289682.1 hypothetical protein -
F6X00_RS11075 2325633..2325764 + 132 WP_182289684.1 DUF3265 domain-containing protein -
F6X00_RS11080 2326127..2326282 + 156 WP_182290885.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - flp1 / VP1611 2163050..2680424 517374
- inside Integron - - 2268354..2394564 126210


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T140446 WP_005377002.1 NZ_CP044206:c2321428-2321138 [Vibrio vulnificus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp

>T140446 NZ_CP059279:c2369019-2368912 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT140446 WP_005377003.1 NZ_CP044206:c2321666-2321418 [Vibrio vulnificus]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp

>AT140446 NZ_CP059279:2369067-2369133 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR03

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References