Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 113966..114603 | Replicon | plasmid unnamed1 |
Accession | NZ_CP044072 | ||
Organism | Pseudomonas oryzihabitans strain FDAARGOS_657 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | FOB65_RS00565 | Protein ID | WP_190971308.1 |
Coordinates | 113966..114364 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | FOB65_RS00570 | Protein ID | WP_150338108.1 |
Coordinates | 114373..114603 (-) | Length | 77 a.a. |
Genomic Context
Location: 109391..109816 (426 bp)
Type: Others
Protein ID: WP_150338104.1
Type: Others
Protein ID: WP_150338104.1
Location: 109913..110674 (762 bp)
Type: Others
Protein ID: Protein_103
Type: Others
Protein ID: Protein_103
Location: 110671..111612 (942 bp)
Type: Others
Protein ID: WP_150338105.1
Type: Others
Protein ID: WP_150338105.1
Location: 111701..113020 (1320 bp)
Type: Others
Protein ID: WP_150338106.1
Type: Others
Protein ID: WP_150338106.1
Location: 113080..113772 (693 bp)
Type: Others
Protein ID: WP_150338132.1
Type: Others
Protein ID: WP_150338132.1
Location: 114841..115122 (282 bp)
Type: Others
Protein ID: WP_150338109.1
Type: Others
Protein ID: WP_150338109.1
Location: 115530..118007 (2478 bp)
Type: Others
Protein ID: WP_150338110.1
Type: Others
Protein ID: WP_150338110.1
Location: 113966..114364 (399 bp)
Type: Toxin
Protein ID: WP_190971308.1
Type: Toxin
Protein ID: WP_190971308.1
Location: 114373..114603 (231 bp)
Type: Antitoxin
Protein ID: WP_150338108.1
Type: Antitoxin
Protein ID: WP_150338108.1
Location: 118419..119075 (657 bp)
Type: Others
Protein ID: WP_150338111.1
Type: Others
Protein ID: WP_150338111.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FOB65_RS00540 | 109391..109816 | + | 426 | WP_150338104.1 | VOC family protein | - |
FOB65_RS00545 | 109913..110674 | + | 762 | Protein_103 | 5-oxoprolinase subunit PxpB | - |
FOB65_RS00550 | 110671..111612 | + | 942 | WP_150338105.1 | biotin-dependent carboxyltransferase family protein | - |
FOB65_RS00555 | 111701..113020 | + | 1320 | WP_150338106.1 | MFS transporter | - |
FOB65_RS00560 | 113080..113772 | + | 693 | WP_150338132.1 | DUF1445 domain-containing protein | - |
FOB65_RS00565 | 113966..114364 | - | 399 | WP_190971308.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
FOB65_RS00570 | 114373..114603 | - | 231 | WP_150338108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
FOB65_RS00575 | 114841..115122 | + | 282 | WP_150338109.1 | hypothetical protein | - |
FOB65_RS00580 | 115530..118007 | + | 2478 | WP_150338110.1 | hypothetical protein | - |
FOB65_RS00585 | 118419..119075 | - | 657 | WP_150338111.1 | HNH endonuclease | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..132067 | 132067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14605.97 Da Isoelectric Point: 7.7788
>T140001 WP_190971308.1 NZ_CP044072:c114364-113966 [Pseudomonas oryzihabitans]
MLDTCICSFIMREHPAAVIRRLSAEVERGNRIVISAITYAEMRYGQIGKKASPKHKVLVDEFVRRLDAVIAWDLRAVDAT
VEVMRQLNAAGTPIGPNDTAIAGHAIAIGCTLVTNNVREFSRIPGLVYEDWV
MLDTCICSFIMREHPAAVIRRLSAEVERGNRIVISAITYAEMRYGQIGKKASPKHKVLVDEFVRRLDAVIAWDLRAVDAT
VEVMRQLNAAGTPIGPNDTAIAGHAIAIGCTLVTNNVREFSRIPGLVYEDWV
Download Length: 399 bp
>T140001 NZ_CP058874:274121-274228 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8438.55 Da Isoelectric Point: 4.5045
>AT140001 WP_150338108.1 NZ_CP044072:c114603-114373 [Pseudomonas oryzihabitans]
MRTVSIFMNGRNQAVRLPQDMAFDGIGELEISKEGDVITLRPARPSWTSLAELPKADADFLQERTAVASDEGRFTL
MRTVSIFMNGRNQAVRLPQDMAFDGIGELEISKEGDVITLRPARPSWTSLAELPKADADFLQERTAVASDEGRFTL
Download Length: 231 bp
>AT140001 NZ_CP058874:c274072-274006 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC