Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 178..114266 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP044035 | ||
| Organism | Klebsiella pneumoniae strain FDAARGOS_630 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | W8EAA6 |
| Locus tag | FOB38_RS00010 | Protein ID | WP_008322213.1 |
| Coordinates | 180..485 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A6C0NE25 |
| Locus tag | FOB38_RS00005 | Protein ID | WP_032934863.1 |
| Coordinates | 114266..178 (+) | Length | -38029 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOB38_RS00010 | 180..485 | + | 306 | WP_008322213.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| FOB38_RS00015 | 487..801 | + | 315 | WP_008322211.1 | hypothetical protein | - |
| FOB38_RS00020 | 791..1582 | + | 792 | WP_008322208.1 | site-specific integrase | - |
| FOB38_RS00025 | 1781..3103 | - | 1323 | WP_016479957.1 | GntP family transporter | - |
| FOB38_RS00030 | 3265..4011 | - | 747 | Protein_5 | IS5 family transposase | - |
| FOB38_RS00045 | 5232..5384 | - | 153 | Protein_7 | IS5/IS1182 family transposase | - |
| FOB38_RS00050 | 5866..6605 | + | 740 | Protein_8 | site-specific integrase | - |
| FOB38_RS00055 | 6901..7890 | - | 990 | WP_022652311.1 | RepB family plasmid replication initiator protein | - |
| FOB38_RS00060 | 8746..9015 | + | 270 | WP_022652312.1 | DUF1778 domain-containing protein | - |
| FOB38_RS00065 | 9019..9549 | + | 531 | WP_016479963.1 | GNAT family N-acetyltransferase | - |
| FOB38_RS00070 | 9681..10697 | + | 1017 | WP_087728544.1 | IS5-like element IS5 family transposase | - |
| FOB38_RS00075 | 10844..11593 | - | 750 | Protein_13 | IS3 family transposase | - |
| FOB38_RS00080 | 11603..11722 | - | 120 | Protein_14 | IS30 family transposase | - |
| FOB38_RS00085 | 11981..12157 | - | 177 | Protein_15 | IS91 family transposase | - |
| FOB38_RS00090 | 12346..13986 | - | 1641 | WP_004201176.1 | chaperonin GroEL | - |
| FOB38_RS00095 | 14042..14332 | - | 291 | WP_004201172.1 | co-chaperone GroES | - |
| FOB38_RS00100 | 14526..14855 | + | 330 | WP_004201171.1 | divalent-cation tolerance protein CutA | - |
| FOB38_RS00105 | 14860..15891 | + | 1032 | WP_004201169.1 | protein-disulfide reductase DsbD N-terminal domain-containing protein | - |
| FOB38_RS00110 | 15902..16540 | - | 639 | WP_004201168.1 | phosphoribosylanthranilate isomerase | - |
| FOB38_RS00115 | 16545..16910 | - | 366 | WP_004201167.1 | bleomycin binding protein Ble-MBL | - |
| FOB38_RS00120 | 16914..17726 | - | 813 | WP_004201164.1 | subclass B1 metallo-beta-lactamase NDM-1 | - |
| FOB38_RS00125 | 18284..19129 | - | 846 | WP_000855769.1 | RmtC family 16S rRNA (guanine(1405)-N(7))-methyltransferase | - |
| FOB38_RS00135 | 19426..20955 | - | 1530 | WP_003149906.1 | IS91 family transposase | - |
| FOB38_RS00140 | 21698..22459 | + | 762 | WP_032072922.1 | DDE-type integrase/transposase/recombinase | - |
| FOB38_RS00145 | 22493..23179 | + | 687 | WP_016479967.1 | Mu transposase C-terminal domain-containing protein | - |
| FOB38_RS00150 | 23176..24108 | + | 933 | WP_015460531.1 | TniB family NTP-binding protein | - |
| FOB38_RS00155 | 24110..25075 | + | 966 | WP_015460530.1 | TniQ family protein | - |
| FOB38_RS00160 | 25163..25621 | + | 459 | Protein_29 | redox-sensitive transcriptional activator SoxR | - |
| FOB38_RS00165 | 25629..26558 | - | 930 | WP_033646557.1 | LysR family transcriptional regulator | - |
| FOB38_RS00170 | 26709..26969 | + | 261 | WP_033637916.1 | DUF1471 domain-containing protein | - |
| FOB38_RS00175 | 27018..28088 | - | 1071 | WP_101456369.1 | fimbrial protein | - |
| FOB38_RS00180 | 28107..30599 | - | 2493 | WP_033646559.1 | fimbrial biogenesis outer membrane usher protein | - |
| FOB38_RS00185 | 30615..31310 | - | 696 | WP_033646560.1 | molecular chaperone | - |
| FOB38_RS00190 | 31359..31943 | - | 585 | WP_033637910.1 | type 1 fimbrial protein | - |
| FOB38_RS00195 | 32505..33767 | - | 1263 | WP_000608644.1 | IS1380-like element ISEc9 family transposase | - |
| FOB38_RS00205 | 34129..34197 | + | 69 | Protein_37 | QacE family quaternary ammonium compound efflux SMR transporter | - |
| FOB38_RS00210 | 34191..35030 | + | 840 | WP_032072921.1 | sulfonamide-resistant dihydropteroate synthase Sul1 | - |
| FOB38_RS00220 | 35158..35400 | + | 243 | WP_000376617.1 | hypothetical protein | - |
| FOB38_RS00225 | 35484..35783 | - | 300 | WP_001183923.1 | DUF2293 domain-containing protein | - |
| FOB38_RS00230 | 35897..36067 | - | 171 | WP_016479969.1 | hypothetical protein | - |
| FOB38_RS00235 | 36400..36951 | + | 552 | Protein_42 | DNA cytosine methyltransferase | - |
| FOB38_RS00245 | 37333..37992 | + | 660 | WP_032072920.1 | endonuclease III | - |
| FOB38_RS00250 | 38201..39076 | - | 876 | Protein_44 | IS5-like element ISKpn26 family transposase | - |
| FOB38_RS00255 | 39145..40137 | - | 993 | WP_001145102.1 | hypothetical protein | - |
| FOB38_RS28065 | 40186..40341 | - | 156 | WP_000074143.1 | hypothetical protein | - |
| FOB38_RS00260 | 40545..41525 | + | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
| FOB38_RS00265 | 41672..42049 | + | 378 | Protein_48 | restriction endonuclease | - |
| FOB38_RS00270 | 42177..42734 | + | 558 | WP_042934582.1 | hypothetical protein | - |
| FOB38_RS00275 | 43178..43759 | - | 582 | WP_045265539.1 | DUF2913 family protein | - |
| FOB38_RS00280 | 43786..44376 | - | 591 | WP_064762226.1 | hypothetical protein | - |
| FOB38_RS00285 | 44391..44684 | - | 294 | WP_032072918.1 | hypothetical protein | - |
| FOB38_RS00290 | 44773..45057 | - | 285 | WP_032072917.1 | hypothetical protein | - |
| FOB38_RS00295 | 45117..45965 | - | 849 | WP_032072916.1 | hypothetical protein | - |
| FOB38_RS28070 | 46104..46250 | + | 147 | WP_032072915.1 | hypothetical protein | - |
| FOB38_RS00320 | 47109..47972 | - | 864 | WP_016247520.1 | incFII family plasmid replication initiator RepA | - |
| FOB38_RS00325 | 47965..48042 | - | 78 | WP_011201829.1 | RepA leader peptide Tap | - |
| FOB38_RS00330 | 48261..48539 | - | 279 | WP_008324932.1 | replication regulatory protein RepA | - |
| FOB38_RS00335 | 48691..49236 | - | 546 | WP_008324931.1 | phospholipase D family protein | - |
| FOB38_RS00340 | 49384..50175 | - | 792 | WP_016479977.1 | DsbA family protein | - |
| FOB38_RS00345 | 50168..50887 | - | 720 | WP_008324922.1 | fertility inhibition protein FinO | - |
| FOB38_RS00350 | 50954..51691 | - | 738 | WP_008324912.1 | type-F conjugative transfer system pilin acetylase TraX | - |
| FOB38_RS00355 | 51693..56933 | - | 5241 | WP_016479978.1 | conjugative transfer relaxase/helicase TraI | - |
| FOB38_RS00360 | 56933..59179 | - | 2247 | WP_016479979.1 | type IV conjugative transfer system coupling protein TraD | - |
| FOB38_RS00365 | 59313..59988 | - | 676 | Protein_65 | sel1 repeat family protein | - |
| FOB38_RS00370 | 60063..60494 | - | 432 | WP_008324118.1 | entry exclusion protein | - |
| FOB38_RS00375 | 60516..63338 | - | 2823 | WP_008324119.1 | conjugal transfer mating pair stabilization protein TraG | - |
| FOB38_RS00380 | 63338..64708 | - | 1371 | WP_016247527.1 | conjugal transfer protein TraH | - |
| FOB38_RS00385 | 64695..65123 | - | 429 | WP_008324122.1 | hypothetical protein | - |
| FOB38_RS00390 | 65116..65670 | - | 555 | WP_008324125.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
| FOB38_RS00395 | 65660..65908 | - | 249 | WP_016479982.1 | type-F conjugative transfer system pilin chaperone TraQ | - |
| FOB38_RS00400 | 65925..66674 | - | 750 | WP_101456333.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
| FOB38_RS00405 | 66705..66893 | - | 189 | WP_008324128.1 | hypothetical protein | - |
| FOB38_RS00410 | 66925..68778 | - | 1854 | WP_016479983.1 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
| FOB38_RS00415 | 68775..69404 | - | 630 | WP_008324130.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
| FOB38_RS00420 | 69421..70407 | - | 987 | WP_042934586.1 | conjugal transfer pilus assembly protein TraU | - |
| FOB38_RS00425 | 70410..71057 | - | 648 | WP_008324132.1 | type-F conjugative transfer system protein TraW | - |
| FOB38_RS00430 | 71057..71404 | - | 348 | WP_008324133.1 | type-F conjugative transfer system protein TrbI | - |
| FOB38_RS00435 | 71401..74031 | - | 2631 | WP_008324134.1 | type IV secretion system protein TraC | - |
| FOB38_RS00440 | 74024..74590 | - | 567 | WP_008324135.1 | conjugal transfer protein TraP | - |
| FOB38_RS00445 | 74580..74981 | - | 402 | WP_016479985.1 | hypothetical protein | - |
| FOB38_RS00450 | 74965..75150 | - | 186 | WP_008324139.1 | hypothetical protein | - |
| FOB38_RS00455 | 75154..75378 | - | 225 | WP_008324141.1 | TraR/DksA C4-type zinc finger protein | - |
| FOB38_RS00460 | 75498..76037 | - | 540 | WP_016247533.1 | type IV conjugative transfer system lipoprotein TraV | - |
| FOB38_RS00465 | 76059..77453 | - | 1395 | WP_016479986.1 | conjugal transfer protein TraB | - |
| FOB38_RS00470 | 77440..78183 | - | 744 | WP_008324157.1 | type-F conjugative transfer system secretin TraK | - |
| FOB38_RS00475 | 78170..78736 | - | 567 | WP_016247535.1 | type IV conjugative transfer system protein TraE | - |
| FOB38_RS00480 | 78751..79056 | - | 306 | WP_008324160.1 | type IV conjugative transfer system protein TraL | - |
| FOB38_RS00485 | 79207..79557 | - | 351 | WP_016247536.1 | type IV conjugative transfer system pilin TraA | - |
| FOB38_RS00490 | 79615..79839 | - | 225 | WP_008324165.1 | TraY domain-containing protein | - |
| FOB38_RS00495 | 79926..80615 | - | 690 | WP_008324166.1 | hypothetical protein | - |
| FOB38_RS00500 | 80804..81196 | - | 393 | WP_008324167.1 | relaxosome protein TraM | - |
| FOB38_RS00505 | 81628..82104 | + | 477 | WP_008324168.1 | transglycosylase SLT domain-containing protein | - |
| FOB38_RS00510 | 82151..82681 | - | 531 | WP_008324170.1 | antirestriction protein | - |
| FOB38_RS00515 | 83308..84138 | - | 831 | WP_008324171.1 | type I restriction-modification system subunit M | - |
| FOB38_RS00520 | 84181..84444 | - | 264 | WP_008324174.1 | hypothetical protein | - |
| FOB38_RS00525 | 84530..84874 | - | 345 | WP_008324177.1 | hypothetical protein | - |
| FOB38_RS00530 | 84921..85208 | - | 288 | WP_008324178.1 | hypothetical protein | - |
| FOB38_RS00535 | 85262..85636 | - | 375 | WP_008324180.1 | hypothetical protein | - |
| FOB38_RS00540 | 86263..86622 | - | 360 | WP_015493069.1 | hypothetical protein | - |
| FOB38_RS00545 | 86684..87007 | - | 324 | WP_008324183.1 | hypothetical protein | - |
| FOB38_RS00550 | 87004..87732 | - | 729 | WP_008324185.1 | plasmid SOS inhibition protein A | - |
| FOB38_RS00555 | 87729..88160 | - | 432 | WP_008324186.1 | conjugation system SOS inhibitor PsiB | - |
| FOB38_RS00560 | 88203..90212 | - | 2010 | WP_016479992.1 | ParB/RepB/Spo0J family partition protein | - |
| FOB38_RS00565 | 90283..90513 | - | 231 | WP_015493071.1 | DUF905 domain-containing protein | - |
| FOB38_RS00570 | 91139..91456 | - | 318 | Protein_106 | hypothetical protein | - |
| FOB38_RS00575 | 91491..91745 | - | 255 | WP_015493072.1 | DNA polymerase III subunit theta | - |
| FOB38_RS00580 | 91938..92129 | - | 192 | WP_015493073.1 | hypothetical protein | - |
| FOB38_RS00585 | 92172..92678 | - | 507 | WP_015493074.1 | antirestriction protein ArdA | - |
| FOB38_RS00590 | 93083..93862 | - | 780 | WP_015493075.1 | hypothetical protein | - |
| FOB38_RS00595 | 93916..94335 | - | 420 | WP_016479994.1 | DUF1380 domain-containing protein | - |
| FOB38_RS00600 | 94346..94567 | - | 222 | WP_015493077.1 | hypothetical protein | - |
| FOB38_RS00605 | 94567..95244 | - | 678 | WP_002211749.1 | DNA methylase | - |
| FOB38_RS00610 | 95603..96274 | + | 672 | WP_015493079.1 | SOS response-associated peptidase family protein | - |
| FOB38_RS00615 | 96498..97718 | + | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| FOB38_RS00620 | 97778..98200 | + | 423 | WP_015493080.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| FOB38_RS00625 | 98200..99471 | + | 1272 | WP_015493081.1 | Y-family DNA polymerase | - |
| FOB38_RS00635 | 99607..100578 | - | 972 | WP_016479949.1 | ParB/RepB/Spo0J family partition protein | - |
| FOB38_RS00640 | 100575..101780 | - | 1206 | WP_015493083.1 | AAA family ATPase | - |
| FOB38_RS00645 | 102143..102775 | + | 633 | WP_016479950.1 | recombinase family protein | - |
| FOB38_RS00650 | 102836..103804 | + | 969 | WP_000654811.1 | IS5 family transposase | - |
| FOB38_RS00655 | 103889..104890 | + | 1002 | WP_139639866.1 | hypothetical protein | - |
| FOB38_RS00660 | 105103..106134 | - | 1032 | WP_001752311.1 | IS630-like element ISEc33 family transposase | - |
| FOB38_RS00665 | 106156..107454 | + | 1299 | WP_157803377.1 | hypothetical protein | - |
| FOB38_RS00670 | 107695..108392 | + | 698 | Protein_125 | IS1 family transposase | - |
| FOB38_RS00675 | 108647..110650 | + | 2004 | WP_016479952.1 | capsular polysaccharide biosynthesis protein | - |
| FOB38_RS00680 | 110740..111984 | + | 1245 | WP_016479953.1 | capsular biosynthesis protein | - |
| FOB38_RS00685 | 112279..112482 | - | 204 | Protein_128 | MerR family transcriptional regulator | - |
| FOB38_RS00690 | 112498..112650 | - | 153 | Protein_129 | IS1 family transposase | - |
| FOB38_RS00695 | 112707..113404 | + | 698 | Protein_130 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-1 / rmtC / sul1 | htpB | 1..114306 | 114306 | |
| - | inside | IScluster/Tn | - | - | 3265..11509 | 8244 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11450.23 Da Isoelectric Point: 5.8211
>T139906 WP_008322213.1 NZ_CP044035:180-485 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
Download Length: 306 bp
>T139906 NZ_CP058849:1767286-1767540 [Shigella flexneri]
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
GTGAAACTAATCTGGTCTGAGGAATCATGGGATGATTATCTGTACTGGCAGGAAACAGATAAGCGAATTGTTAAAAAGAT
CAATGAACTTATCAAAGATACCCGCAGAACGCCATTTGAAGGTAAGGGGAAGCCAGAACCCCTGAAACATAATTTGTCAG
GTTTCTGGTCCCGACGCATTACAGAGGAGCACCGTCTGGTATACGCGGTTACCGACGATTCACTGCTCATTGCAGCATGT
CGTTATCATTATTGA
Antitoxin
Download Length: -38029 a.a. Molecular weight: 9307.58 Da Isoelectric Point: 4.7954
>AT139906 WP_032934863.1 NZ_CP044035:114266-178 [Klebsiella pneumoniae]
Download Length: -114087 bp
>AT139906 NZ_CP058849:1767038-1767289 [Shigella flexneri]
ATGCGTACAATTAGTTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTCATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGTTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACGGAAAAGGAC
ATTATTGAGTGA
ATGCGTACAATTAGTTACAGCGAAGCGCGTCAGAATTTGTCGGCAACAATGATGAAAGCCGTTGAAGATCATGCCCCGAT
CCTCATTACTCGTCAGAATGGAGAGGCTTGTGTTCTGATGTCACTCGAAGAATACAACTCGCTGGAAGAGACGGCTTATC
TACTGCGTTCCCCCGCTAACGCCCGGAGATTGATGGACTCAATCGATAGCCTGAAATCAGGCAAAGGAACGGAAAAGGAC
ATTATTGAGTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE27 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE25 |