Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-yefM/YoeB-YefM |
Location | 112052..112567 | Replicon | chromosome |
Accession | NZ_CP043849 | ||
Organism | Micrococcus luteus strain NCCP 15687 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A4Y1LR91 |
Locus tag | F1717_RS00585 | Protein ID | WP_041103932.1 |
Coordinates | 112313..112567 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A229HG25 |
Locus tag | F1717_RS00580 | Protein ID | WP_036340860.1 |
Coordinates | 112052..112312 (+) | Length | 87 a.a. |
Genomic Context
Location: 107981..108547 (567 bp)
Type: Others
Protein ID: WP_158184352.1
Type: Others
Protein ID: WP_158184352.1
Location: 112052..112312 (261 bp)
Type: Antitoxin
Protein ID: WP_036340860.1
Type: Antitoxin
Protein ID: WP_036340860.1
Location: 112313..112567 (255 bp)
Type: Toxin
Protein ID: WP_041103932.1
Type: Toxin
Protein ID: WP_041103932.1
Location: 112569..113135 (567 bp)
Type: Others
Protein ID: WP_041103934.1
Type: Others
Protein ID: WP_041103934.1
Location: 113328..113573 (246 bp)
Type: Others
Protein ID: WP_078025880.1
Type: Others
Protein ID: WP_078025880.1
Location: 115931..116149 (219 bp)
Type: Others
Protein ID: Protein_123
Type: Others
Protein ID: Protein_123
Location: 116162..116641 (480 bp)
Type: Others
Protein ID: WP_036316396.1
Type: Others
Protein ID: WP_036316396.1
Location: 108860..109276 (417 bp)
Type: Others
Protein ID: Protein_113
Type: Others
Protein ID: Protein_113
Location: 109278..110433 (1156 bp)
Type: Others
Protein ID: Protein_114
Type: Others
Protein ID: Protein_114
Location: 110463..111866 (1404 bp)
Type: Others
Protein ID: WP_155932746.1
Type: Others
Protein ID: WP_155932746.1
Location: 113587..114369 (783 bp)
Type: Others
Protein ID: WP_158184353.1
Type: Others
Protein ID: WP_158184353.1
Location: 114369..114911 (543 bp)
Type: Others
Protein ID: WP_036340843.1
Type: Others
Protein ID: WP_036340843.1
Location: 114908..115633 (726 bp)
Type: Others
Protein ID: WP_152744175.1
Type: Others
Protein ID: WP_152744175.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F1717_RS00560 | 107981..108547 | + | 567 | WP_158184352.1 | hypothetical protein | - |
F1717_RS00565 | 108860..109276 | - | 417 | Protein_113 | phosphatidylinositol kinase | - |
F1717_RS00570 | 109278..110433 | - | 1156 | Protein_114 | glycerate kinase | - |
F1717_RS00575 | 110463..111866 | - | 1404 | WP_155932746.1 | GntP family permease | - |
F1717_RS00580 | 112052..112312 | + | 261 | WP_036340860.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
F1717_RS00585 | 112313..112567 | + | 255 | WP_041103932.1 | Txe/YoeB family addiction module toxin | Toxin |
F1717_RS00590 | 112569..113135 | + | 567 | WP_041103934.1 | mismatch-specific DNA-glycosylase | - |
F1717_RS00595 | 113328..113573 | + | 246 | WP_078025880.1 | hypothetical protein | - |
F1717_RS00600 | 113587..114369 | - | 783 | WP_158184353.1 | SCO1664 family protein | - |
F1717_RS00605 | 114369..114911 | - | 543 | WP_036340843.1 | DUF3090 domain-containing protein | - |
F1717_RS00610 | 114908..115633 | - | 726 | WP_152744175.1 | MSMEG_4193 family putative phosphomutase | - |
F1717_RS00615 | 115931..116149 | + | 219 | Protein_123 | hypothetical protein | - |
F1717_RS00620 | 116162..116641 | + | 480 | WP_036316396.1 | NUDIX hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9996.33 Da Isoelectric Point: 7.3149
>T139369 WP_041103932.1 NZ_CP043849:112313-112567 [Micrococcus luteus]
VRLVWDRSAWEDYTHWQTTDRKVLKRINTLIDAALRDPFDGIGKPEQLKYGAPGAWSRRITEEHRLVYLVDGEDLIILQA
RYHY
VRLVWDRSAWEDYTHWQTTDRKVLKRINTLIDAALRDPFDGIGKPEQLKYGAPGAWSRRITEEHRLVYLVDGEDLIILQA
RYHY
Download Length: 255 bp
>T139369 NZ_CP058658:c82183-81977 [Escherichia coli]
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCCTTGCAGGGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACCTTAACACTACTGATTGTAGCCTCTTCCTTGCAGGGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 87 a.a. Molecular weight: 9597.74 Da Isoelectric Point: 4.8359
>AT139369 WP_036340860.1 NZ_CP043849:112052-112312 [Micrococcus luteus]
MSISASEARKTLFPLIERVNADRDAVEIVSRKGNAVLMPADEYAAWQETAYLFRSPANARRLLDAYERARAGSVEEHALD
RMDGDA
MSISASEARKTLFPLIERVNADRDAVEIVSRKGNAVLMPADEYAAWQETAYLFRSPANARRLLDAYERARAGSVEEHALD
RMDGDA
Download Length: 261 bp
>AT139369 NZ_CP058658:82170-82231 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y1LR91 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A229HG25 |