Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 463..2503380 | Replicon | chromosome |
| Accession | NZ_CP043847 | ||
| Organism | Staphylococcus epidermidis strain NCCP 16828 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | F1614_RS00010 | Protein ID | WP_002474496.1 |
| Coordinates | 487..669 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | F1614_RS00005 | Protein ID | WP_002476983.1 |
| Coordinates | 2503380..463 (+) | Length | -834305.33333333 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F1614_RS00010 | 487..669 | + | 183 | WP_002474496.1 | hypothetical protein | Toxin |
| F1614_RS00015 | 821..1225 | + | 405 | WP_002474495.1 | hypothetical protein | - |
| F1614_RS00020 | 1410..2795 | + | 1386 | WP_158171670.1 | class II fumarate hydratase | - |
| F1614_RS00025 | 3156..3980 | - | 825 | WP_017464598.1 | RluA family pseudouridine synthase | - |
| F1614_RS00030 | 4139..5272 | + | 1134 | WP_158171671.1 | GAF domain-containing sensor histidine kinase | - |
| F1614_RS00035 | 5265..5888 | + | 624 | WP_001829810.1 | response regulator transcription factor | - |
| F1614_RS00040 | 6159..6623 | + | 465 | WP_001829807.1 | helix-turn-helix transcriptional regulator | - |
| F1614_RS00045 | 6804..7934 | + | 1131 | WP_002498161.1 | DUF445 domain-containing protein | - |
| F1614_RS00050 | 8007..8351 | + | 345 | WP_001829805.1 | YlbF/YmcA family competence regulator | - |
| F1614_RS00055 | 8622..9818 | + | 1197 | WP_002476976.1 | DNA repair exonuclease | - |
| F1614_RS00060 | 9808..12747 | + | 2940 | WP_158171672.1 | AAA family ATPase | - |
| F1614_RS00065 | 12744..13685 | + | 942 | WP_002493972.1 | 3'-5' exoribonuclease YhaM | - |
| F1614_RS00070 | 13860..13961 | + | 102 | WP_161375074.1 | type I toxin-antitoxin system Fst family toxin | - |
| F1614_RS00075 | 14111..15088 | - | 978 | WP_017464595.1 | peptidylprolyl isomerase | - |
| F1614_RS00080 | 15290..15850 | - | 561 | WP_001829837.1 | DUF3267 domain-containing protein | - |
| F1614_RS00085 | 16016..16387 | - | 372 | WP_017464594.1 | YtxH domain-containing protein | - |
| F1614_RS00090 | 16464..16889 | - | 426 | WP_001829828.1 | HIT family protein | - |
| F1614_RS00095 | 17019..17759 | + | 741 | WP_002474664.1 | ABC transporter ATP-binding protein | - |
| F1614_RS00100 | 17752..18975 | + | 1224 | WP_017464593.1 | ABC transporter permease | - |
| F1614_RS00105 | 19034..19651 | + | 618 | WP_002498156.1 | CadD family cadmium resistance transporter | - |
| F1614_RS00110 | 20246..20749 | - | 504 | WP_017464592.1 | signal transduction protein TRAP | - |
| F1614_RS00115 | 21042..22103 | + | 1062 | WP_161935967.1 | uroporphyrinogen decarboxylase | - |
| F1614_RS00120 | 22180..23103 | + | 924 | WP_017464590.1 | ferrochelatase | - |
| F1614_RS00125 | 23247..24644 | + | 1398 | WP_017464589.1 | protoporphyrinogen oxidase | - |
| F1614_RS00130 | 24780..25334 | + | 555 | WP_017464588.1 | alpha/beta hydrolase | - |
| F1614_RS00175 | 27517..27714 | + | 198 | WP_017464587.1 | hypothetical protein | - |
| F1614_RS00180 | 27890..29131 | + | 1242 | WP_017464586.1 | Fic family protein | - |
| F1614_RS00190 | 29638..29913 | - | 276 | WP_158171976.1 | phage integrase SAM-like domain-containing protein | - |
| F1614_RS00195 | 30157..30810 | - | 654 | WP_017464584.1 | Ltp family lipoprotein | - |
| F1614_RS00205 | 32058..33482 | + | 1425 | WP_158171673.1 | o-succinylbenzoate--CoA ligase | - |
| F1614_RS00210 | 33472..34473 | + | 1002 | WP_017464582.1 | o-succinylbenzoate synthase | - |
| F1614_RS00215 | 34470..34718 | - | 249 | WP_002457867.1 | membrane protein insertion efficiency factor YidD | - |
| F1614_RS00220 | 34789..35256 | + | 468 | WP_199253290.1 | nucleoside triphosphatase YtkD | - |
| F1614_RS00225 | 35243..36028 | + | 786 | WP_017464581.1 | S9 family peptidase | - |
| F1614_RS00230 | 36259..37851 | - | 1593 | WP_017464580.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
| F1614_RS00235 | 38221..39420 | + | 1200 | WP_001829830.1 | methionine adenosyltransferase | - |
| F1614_RS00240 | 39523..40431 | + | 909 | WP_002476959.1 | hypothetical protein | - |
| F1614_RS00245 | 40613..41449 | + | 837 | WP_017464578.1 | aldo/keto reductase | - |
| F1614_RS00250 | 41701..42054 | - | 354 | WP_017464577.1 | CrcB family protein | - |
| F1614_RS00255 | 42051..42416 | - | 366 | WP_002476956.1 | fluoride efflux transporter CrcB | - |
| F1614_RS00260 | 42456..42764 | - | 309 | WP_002487559.1 | hypothetical protein | - |
| F1614_RS00265 | 43041..43754 | + | 714 | WP_002476955.1 | transaldolase | - |
| F1614_RS00270 | 43894..44337 | + | 444 | WP_059279942.1 | hypothetical protein | - |
| F1614_RS00275 | 44324..44767 | - | 444 | WP_002498013.1 | competence protein ComK | - |
| F1614_RS00280 | 44773..45252 | - | 480 | WP_017464574.1 | sigma-70 family RNA polymerase sigma factor | - |
| F1614_RS00290 | 45459..45674 | + | 216 | WP_002456441.1 | hypothetical protein | - |
| F1614_RS00295 | 46052..46903 | + | 852 | WP_001830727.1 | N-acetylglucosaminidase | - |
| F1614_RS00300 | 47251..48735 | + | 1485 | WP_017464573.1 | FAD/NAD(P)-binding protein | - |
| F1614_RS00305 | 49171..50214 | + | 1044 | WP_002440254.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
| F1614_RS00310 | 50221..50853 | + | 633 | WP_002467848.1 | riboflavin synthase | - |
| F1614_RS00315 | 50866..52047 | + | 1182 | WP_017464571.1 | bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II | - |
| F1614_RS00320 | 52060..52521 | + | 462 | WP_002474722.1 | 6,7-dimethyl-8-ribityllumazine synthase | - |
| F1614_RS00325 | 52569..53570 | - | 1002 | WP_017464570.1 | proline dehydrogenase | - |
| F1614_RS00330 | 53813..54640 | + | 828 | WP_002489440.1 | alpha/beta hydrolase | - |
| F1614_RS00335 | 55130..55531 | + | 402 | WP_001830809.1 | SarA family transcriptional regulator | - |
| F1614_RS00340 | 55768..56331 | - | 564 | WP_017464569.1 | methyltransferase domain-containing protein | - |
| F1614_RS00345 | 56328..57281 | - | 954 | WP_001830802.1 | TIGR01212 family radical SAM protein | - |
| F1614_RS00350 | 57389..58603 | + | 1215 | WP_002498006.1 | MFS transporter | - |
| F1614_RS00355 | 58891..61308 | + | 2418 | WP_029376553.1 | leucine--tRNA ligase | - |
| F1614_RS00360 | 61334..61645 | + | 312 | WP_158171675.1 | rhodanese-like domain-containing protein | - |
| F1614_RS00365 | 62049..73127 | + | 11079 | Protein_61 | DUF1542 domain-containing protein | - |
| F1614_RS00370 | 73321..74583 | - | 1263 | WP_002474721.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| F1614_RS00375 | 74856..76517 | + | 1662 | WP_158171676.1 | polysaccharide biosynthesis protein | - |
| F1614_RS00380 | 76514..77206 | + | 693 | WP_002498004.1 | rRNA pseudouridine synthase | - |
| F1614_RS00385 | 77224..77652 | + | 429 | WP_002474687.1 | YtxH domain-containing protein | - |
| F1614_RS00390 | 77958..79367 | + | 1410 | WP_017464565.1 | dipeptidase PepV | - |
| F1614_RS00395 | 79371..80219 | + | 849 | WP_001830829.1 | D-amino-acid transaminase | - |
| F1614_RS00400 | 80607..81398 | + | 792 | WP_001830846.1 | phosphotransferase family protein | - |
| F1614_RS00405 | 81412..82059 | + | 648 | WP_002493957.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| F1614_RS00410 | 82219..82533 | - | 315 | WP_002474691.1 | PepSY domain-containing protein | - |
| F1614_RS00415 | 82618..83703 | + | 1086 | WP_158171677.1 | M42 family metallopeptidase | - |
| F1614_RS00420 | 83709..84020 | + | 312 | WP_002474681.1 | thioredoxin family protein | - |
| F1614_RS00425 | 84158..85012 | + | 855 | WP_002474719.1 | DUF1444 domain-containing protein | - |
| F1614_RS00430 | 85035..85631 | + | 597 | WP_001830779.1 | DUF4479 domain-containing tRNA-binding protein | - |
| F1614_RS00435 | 85652..89161 | + | 3510 | WP_158171678.1 | DNA translocase FtsK | - |
| F1614_RS00440 | 89182..90495 | + | 1314 | WP_158171679.1 | UDP-N-acetylmuramate--L-alanine ligase | - |
| F1614_RS00445 | 90570..91061 | + | 492 | WP_001830868.1 | DUF948 domain-containing protein | - |
| F1614_RS00450 | 91139..92362 | + | 1224 | WP_199253291.1 | YtxH domain-containing protein | - |
| F1614_RS00455 | 92797..93888 | + | 1092 | WP_001830908.1 | bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase | - |
| F1614_RS00460 | 94144..95133 | + | 990 | WP_017464562.1 | catabolite control protein A | - |
| F1614_RS00465 | 95552..97219 | + | 1668 | WP_017464561.1 | formate--tetrahydrofolate ligase | - |
| F1614_RS00470 | 97306..98211 | - | 906 | WP_017464560.1 | penicillin-binding protein | - |
| F1614_RS00475 | 98615..99880 | + | 1266 | WP_070636926.1 | tyrosine--tRNA ligase | - |
| F1614_RS00480 | 100072..101310 | - | 1239 | WP_017464558.1 | S1C family serine protease | - |
| F1614_RS00485 | 101590..102213 | + | 624 | WP_002474689.1 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
| F1614_RS00490 | 102423..103895 | + | 1473 | WP_017464557.1 | N-acetylglucosamine-specific PTS transporter subunit IIBC | - |
| F1614_RS00495 | 103991..105115 | + | 1125 | WP_158171681.1 | HAD hydrolase-like protein | - |
| F1614_RS00500 | 105195..106790 | - | 1596 | WP_158171682.1 | phosphoglycerate dehydrogenase | - |
| F1614_RS00505 | 106780..107943 | - | 1164 | WP_002476925.1 | alanine--glyoxylate aminotransferase family protein | - |
| F1614_RS00510 | 108070..108510 | - | 441 | WP_001830816.1 | SACOL1771 family peroxiredoxin | - |
| F1614_RS00515 | 108588..109334 | + | 747 | WP_002493951.1 | glycerophosphodiester phosphodiesterase | - |
| F1614_RS00520 | 109605..110207 | - | 603 | WP_017465295.1 | 30S ribosomal protein S4 | - |
| F1614_RS00530 | 110428..110898 | - | 471 | WP_002474667.1 | GAF domain-containing protein | - |
| F1614_RS00535 | 111033..112727 | + | 1695 | WP_002468056.1 | septation ring formation regulator EzrA | - |
| F1614_RS00540 | 113033..113515 | + | 483 | WP_002458050.1 | IS200/IS605-like element ISSep3 family transposase | - |
| F1614_RS00545 | 113796..114935 | + | 1140 | WP_002476923.1 | cysteine desulfurase | - |
| F1614_RS00550 | 114935..116158 | + | 1224 | WP_158171683.1 | tRNA 4-thiouridine(8) synthase ThiI | - |
| F1614_RS00555 | 116198..116962 | + | 765 | WP_059223828.1 | TSUP family transporter | - |
| F1614_RS00560 | 117202..117696 | + | 495 | WP_001832701.1 | thiol peroxidase | - |
| F1614_RS00565 | 117825..118772 | + | 948 | WP_158171684.1 | class I SAM-dependent methyltransferase | - |
| F1614_RS00570 | 118861..120114 | + | 1254 | WP_002476920.1 | acetate kinase | - |
| F1614_RS00575 | 120761..121261 | - | 501 | WP_017465291.1 | universal stress protein | - |
| F1614_RS00580 | 121409..122524 | + | 1116 | WP_002476918.1 | alanine dehydrogenase | - |
| F1614_RS00585 | 122588..123643 | - | 1056 | WP_002476917.1 | Xaa-Pro peptidase family protein | - |
| F1614_RS00590 | 123815..124504 | + | 690 | WP_158171685.1 | metal-dependent hydrolase | - |
| F1614_RS00595 | 124805..125218 | - | 414 | WP_002446667.1 | universal stress protein | - |
| F1614_RS00600 | 125416..126714 | + | 1299 | WP_002473982.1 | CBS domain-containing protein | - |
| F1614_RS00605 | 126748..127686 | + | 939 | WP_158171686.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| F1614_RS00610 | 127710..130907 | + | 3198 | WP_158171687.1 | DNA polymerase III subunit alpha | - |
| F1614_RS00615 | 131211..132440 | + | 1230 | WP_158171688.1 | NAD-dependent malic enzyme | - |
| F1614_RS00620 | 132539..133396 | + | 858 | WP_017465249.1 | acetyl-CoA carboxylase, carboxyltransferase subunit beta | - |
| F1614_RS00625 | 133396..134340 | + | 945 | WP_002440194.1 | acetyl-CoA carboxylase carboxyltransferase subunit alpha | - |
| F1614_RS00630 | 134518..135486 | + | 969 | WP_002476912.1 | 6-phosphofructokinase | - |
| F1614_RS00635 | 135509..137266 | + | 1758 | WP_001830831.1 | pyruvate kinase | - |
| F1614_RS00640 | 137500..137982 | + | 483 | WP_002458050.1 | IS200/IS605-like element ISSep3 family transposase | - |
| F1614_RS00645 | 138459..139814 | - | 1356 | WP_002473985.1 | amino acid permease | - |
| F1614_RS00650 | 140162..141283 | + | 1122 | WP_158171689.1 | citrate synthase | - |
| F1614_RS00655 | 141326..142594 | + | 1269 | WP_001830826.1 | NADP-dependent isocitrate dehydrogenase | - |
| F1614_RS00660 | 142910..143620 | + | 711 | WP_002473983.1 | response regulator transcription factor | - |
| F1614_RS00665 | 143620..145317 | + | 1698 | WP_002493941.1 | GHKL domain-containing protein | - |
| F1614_RS00670 | 145626..148256 | + | 2631 | WP_158171690.1 | DNA polymerase I | - |
| F1614_RS00675 | 148272..149144 | + | 873 | WP_017465252.1 | bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase | - |
| F1614_RS00680 | 149160..149771 | + | 612 | WP_002473990.1 | dephospho-CoA kinase | - |
| F1614_RS12525 | 150126..150508 | + | 383 | Protein_124 | transposase | - |
| F1614_RS00695 | 150614..151639 | + | 1026 | WP_158171691.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| F1614_RS00700 | 152161..152631 | + | 471 | WP_001830825.1 | transcriptional regulator NrdR | - |
| F1614_RS00705 | 152632..154002 | + | 1371 | WP_002497978.1 | DnaD domain protein | - |
| F1614_RS00710 | 154002..154922 | + | 921 | WP_017464979.1 | primosomal protein DnaI | - |
| F1614_RS00715 | 155275..157212 | + | 1938 | WP_158171692.1 | threonine--tRNA ligase | - |
| F1614_RS00720 | 157641..159143 | + | 1503 | WP_002474760.1 | amino acid permease | - |
| F1614_RS00725 | 159351..159878 | + | 528 | WP_001830789.1 | translation initiation factor IF-3 | - |
| F1614_RS00730 | 159906..160106 | + | 201 | WP_001830767.1 | 50S ribosomal protein L35 | - |
| F1614_RS00735 | 160156..160512 | + | 357 | WP_001830839.1 | 50S ribosomal protein L20 | - |
| F1614_RS00740 | 160930..161541 | + | 612 | WP_017464981.1 | NUDIX domain-containing protein | - |
| F1614_RS00745 | 161558..162481 | + | 924 | WP_017464982.1 | hypothetical protein | - |
| F1614_RS00750 | 162641..163942 | + | 1302 | WP_145355167.1 | trigger factor | - |
| F1614_RS00755 | 164229..165491 | + | 1263 | WP_001830765.1 | ATP-dependent Clp protease ATP-binding subunit ClpX | - |
| F1614_RS00760 | 165603..166190 | + | 588 | WP_017464984.1 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
| F1614_RS00765 | 166360..167706 | + | 1347 | WP_001830773.1 | glutamyl-tRNA reductase | - |
| F1614_RS00770 | 167728..168540 | + | 813 | WP_002474770.1 | cytochrome c biogenesis protein CcsA | - |
| F1614_RS00775 | 168594..169520 | + | 927 | WP_017464986.1 | hydroxymethylbilane synthase | - |
| F1614_RS00780 | 169554..170234 | + | 681 | WP_002474751.1 | uroporphyrinogen-III synthase | - |
| F1614_RS00785 | 170224..171198 | + | 975 | WP_002474755.1 | porphobilinogen synthase | - |
| F1614_RS00790 | 171222..172505 | + | 1284 | WP_002497969.1 | glutamate-1-semialdehyde 2,1-aminomutase | - |
| F1614_RS00795 | 172854..173921 | + | 1068 | WP_158171693.1 | AbrB family transcriptional regulator | - |
| F1614_RS00800 | 174088..174648 | - | 561 | WP_002474761.1 | DNA-3-methyladenine glycosylase I | - |
| F1614_RS00805 | 174991..177621 | + | 2631 | WP_158171694.1 | valine--tRNA ligase | - |
| F1614_RS00810 | 177632..178897 | + | 1266 | WP_002440172.1 | bifunctional folylpolyglutamate synthase/dihydrofolate synthase | - |
| F1614_RS00815 | 179081..179791 | + | 711 | WP_017464988.1 | A24 family peptidase | - |
| F1614_RS00820 | 179788..180468 | + | 681 | WP_002474752.1 | DNA repair protein RadC | - |
| F1614_RS00825 | 180532..180711 | - | 180 | WP_002446629.1 | hypothetical protein | - |
| F1614_RS00830 | 180876..181361 | + | 486 | WP_001832708.1 | DUF4930 family protein | - |
| F1614_RS00835 | 181445..181585 | + | 141 | WP_001830756.1 | hypothetical protein | - |
| F1614_RS00840 | 181991..182830 | + | 840 | WP_002476886.1 | rod shape-determining protein MreC | - |
| F1614_RS00845 | 182830..183351 | + | 522 | WP_002474749.1 | rod shape-determining protein MreD | - |
| F1614_RS00850 | 183473..183781 | + | 309 | WP_001830820.1 | 50S ribosomal protein L21 | - |
| F1614_RS00855 | 183786..184106 | + | 321 | WP_017464989.1 | ribosomal-processing cysteine protease Prp | - |
| F1614_RS00860 | 184118..184402 | + | 285 | WP_001830822.1 | 50S ribosomal protein L27 | - |
| F1614_RS00865 | 184548..185840 | + | 1293 | WP_017464990.1 | GTPase ObgE | - |
| F1614_RS00870 | 185852..186307 | + | 456 | WP_001830784.1 | ACT domain-containing protein | - |
| F1614_RS00875 | 186320..186922 | + | 603 | WP_001830895.1 | Holliday junction branch migration protein RuvA | - |
| F1614_RS00880 | 186936..187940 | + | 1005 | WP_002476884.1 | Holliday junction branch migration DNA helicase RuvB | - |
| F1614_RS00885 | 187942..188967 | + | 1026 | WP_002474765.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
| F1614_RS00890 | 188988..190127 | + | 1140 | WP_002474775.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| F1614_RS00895 | 190143..190403 | + | 261 | WP_001830800.1 | preprotein translocase subunit YajC | - |
| F1614_RS00900 | 190753..193044 | + | 2292 | WP_017464992.1 | protein translocase subunit SecDF | - |
| F1614_RS00905 | 193715..195988 | + | 2274 | WP_017464636.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| F1614_RS00910 | 196007..196525 | + | 519 | WP_002476881.1 | adenine phosphoribosyltransferase | - |
| F1614_RS00920 | 197047..199236 | + | 2190 | WP_158171695.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| F1614_RS00925 | 199250..199702 | + | 453 | WP_001830766.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| F1614_RS00930 | 199699..200574 | + | 876 | WP_002468514.1 | N-acetylmuramoyl-L-alanine amidase | - |
| F1614_RS00935 | 200946..202220 | + | 1275 | WP_002474063.1 | histidine--tRNA ligase | - |
| F1614_RS00940 | 202223..203989 | + | 1767 | WP_002476878.1 | aspartate--tRNA ligase | - |
| F1614_RS00950 | 204603..205379 | + | 777 | WP_002473628.1 | tRNA threonylcarbamoyladenosine dehydratase | - |
| F1614_RS00955 | 205572..206843 | - | 1272 | WP_002473685.1 | replication-associated recombination protein A | - |
| F1614_RS00960 | 206929..207351 | + | 423 | WP_001830806.1 | Rrf2 family transcriptional regulator | - |
| F1614_RS00965 | 207537..207680 | + | 144 | WP_002473564.1 | hypothetical protein | - |
| F1614_RS00970 | 207880..208875 | - | 996 | WP_017464637.1 | LLM class flavin-dependent oxidoreductase | - |
| F1614_RS00975 | 209120..210262 | + | 1143 | WP_002494287.1 | cysteine desulfurase | - |
| F1614_RS00980 | 210262..211380 | + | 1119 | WP_002494288.1 | tRNA 2-thiouridine(34) synthase MnmA | - |
| F1614_RS00985 | 211543..212211 | + | 669 | WP_001832695.1 | tetratricopeptide repeat protein | - |
| F1614_RS00990 | 212213..214645 | + | 2433 | WP_002476874.1 | ATP-dependent RecD-like DNA helicase | - |
| F1614_RS00995 | 214974..217604 | + | 2631 | WP_002473650.1 | alanine--tRNA ligase | - |
| F1614_RS01000 | 217668..217928 | + | 261 | WP_001830883.1 | IreB family regulatory phosphoprotein | - |
| F1614_RS01005 | 217930..218358 | + | 429 | WP_001830837.1 | Holliday junction resolvase RuvX | - |
| F1614_RS01010 | 218373..218681 | + | 309 | WP_001830855.1 | DUF1292 domain-containing protein | - |
| F1614_RS01015 | 219110..219745 | + | 636 | WP_001830827.1 | O-methyltransferase | - |
| F1614_RS01020 | 219748..220671 | + | 924 | WP_059223769.1 | U32 family peptidase | - |
| F1614_RS01025 | 220689..221957 | + | 1269 | WP_002473622.1 | U32 family peptidase | - |
| F1614_RS01030 | 221957..222580 | + | 624 | WP_002446596.1 | uridine kinase | - |
| F1614_RS01035 | 222611..223087 | + | 477 | WP_002457767.1 | transcription elongation factor GreA | - |
| F1614_RS01040 | 223648..224379 | + | 732 | WP_017464640.1 | 5-oxoprolinase subunit PxpB | - |
| F1614_RS01045 | 224369..225373 | + | 1005 | WP_002476869.1 | biotin-dependent carboxyltransferase family protein | - |
| F1614_RS01050 | 225374..225814 | + | 441 | WP_001832766.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | - |
| F1614_RS01055 | 225828..227186 | + | 1359 | WP_002497951.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| F1614_RS01060 | 227189..227941 | + | 753 | WP_199253292.1 | 5-oxoprolinase subunit PxpA | - |
| F1614_RS01065 | 227953..229197 | + | 1245 | WP_002473567.1 | divalent metal cation transporter | - |
| F1614_RS01070 | 229396..230082 | + | 687 | WP_017464643.1 | 5'-methylthioadenosine/adenosylhomocysteine nucleosidase | - |
| F1614_RS01075 | 230102..230629 | + | 528 | WP_158171697.1 | YqeG family HAD IIIA-type phosphatase | - |
| F1614_RS01080 | 230630..231730 | + | 1101 | WP_002473740.1 | ribosome biogenesis GTPase YqeH | - |
| F1614_RS01085 | 231746..232555 | + | 810 | WP_002468439.1 | shikimate dehydrogenase | - |
| F1614_RS01090 | 232555..232845 | + | 291 | WP_017464644.1 | ribosome assembly RNA-binding protein YhbY | - |
| F1614_RS01095 | 232845..233420 | + | 576 | WP_001831250.1 | nicotinate-nucleotide adenylyltransferase | - |
| F1614_RS01100 | 233407..233991 | + | 585 | WP_017464645.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| F1614_RS01105 | 233992..234345 | + | 354 | WP_001831075.1 | ribosome silencing factor | - |
| F1614_RS01110 | 234348..235067 | + | 720 | WP_158171698.1 | class I SAM-dependent methyltransferase | - |
| F1614_RS01115 | 235126..235800 | + | 675 | WP_017464646.1 | helix-hairpin-helix domain-containing protein | - |
| F1614_RS01120 | 235880..236341 | + | 462 | WP_002440103.1 | ComE operon protein 2 | - |
| F1614_RS01125 | 236345..238561 | + | 2217 | WP_158171699.1 | DNA internalization-related competence protein ComEC/Rec2 | - |
| F1614_RS01130 | 238606..239580 | + | 975 | WP_001831125.1 | DNA polymerase III subunit delta | - |
| F1614_RS01135 | 239699..239950 | - | 252 | WP_001831221.1 | 30S ribosomal protein S20 | - |
| F1614_RS01140 | 240243..242066 | + | 1824 | WP_001831284.1 | translation elongation factor 4 | - |
| F1614_RS01145 | 242185..243309 | + | 1125 | WP_002473539.1 | oxygen-independent coproporphyrinogen III oxidase | - |
| F1614_RS01150 | 243409..244386 | + | 978 | WP_017464647.1 | heat-inducible transcriptional repressor HrcA | - |
| F1614_RS01155 | 244415..245047 | + | 633 | WP_002473652.1 | nucleotide exchange factor GrpE | - |
| F1614_RS01160 | 245103..246932 | + | 1830 | WP_002473568.1 | molecular chaperone DnaK | - |
| F1614_RS01165 | 247077..248198 | + | 1122 | WP_002457747.1 | molecular chaperone DnaJ | - |
| F1614_RS01170 | 248202..249140 | + | 939 | WP_002473619.1 | 50S ribosomal protein L11 methyltransferase | - |
| F1614_RS01175 | 249142..249894 | + | 753 | WP_029376563.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| F1614_RS01180 | 249900..251246 | + | 1347 | WP_158171700.1 | tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB | - |
| F1614_RS01185 | 251372..251548 | + | 177 | WP_000048060.1 | 30S ribosomal protein S21 | - |
| F1614_RS01190 | 252405..253115 | + | 711 | WP_017464649.1 | hypothetical protein | - |
| F1614_RS01195 | 253130..254119 | + | 990 | WP_001830989.1 | flotillin-like protein FloA | - |
| F1614_RS01200 | 254135..254818 | + | 684 | WP_002473752.1 | hypothetical protein | - |
| F1614_RS01205 | 255105..256052 | + | 948 | WP_001831049.1 | PhoH family protein | - |
| F1614_RS01210 | 256053..256520 | + | 468 | WP_017464650.1 | rRNA maturation RNase YbeY | - |
| F1614_RS01215 | 256522..256878 | + | 357 | WP_002473747.1 | diacylglycerol kinase family protein | - |
| F1614_RS01220 | 256878..257282 | + | 405 | WP_002473664.1 | cytidine deaminase | - |
| F1614_RS01225 | 257282..258181 | + | 900 | WP_001831081.1 | GTPase Era | - |
| F1614_RS01230 | 258207..258968 | + | 762 | WP_002473715.1 | DNA repair protein RecO | - |
| F1614_RS01235 | 259098..260489 | - | 1392 | WP_002456487.1 | glycine--tRNA ligase | - |
| F1614_RS01240 | 260825..261448 | + | 624 | WP_074838316.1 | helix-turn-helix transcriptional regulator | - |
| F1614_RS01245 | 261460..262278 | + | 819 | WP_002473706.1 | kinase/pyrophosphorylase | - |
| F1614_RS01250 | 262452..264248 | + | 1797 | WP_158171701.1 | DNA primase | - |
| F1614_RS01255 | 264518..265624 | + | 1107 | WP_002440071.1 | RNA polymerase sigma factor RpoD | - |
| F1614_RS01260 | 265779..266468 | + | 690 | WP_002473692.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| F1614_RS01265 | 266458..267558 | + | 1101 | WP_017464654.1 | Nif3-like dinuclear metal center hexameric protein | - |
| F1614_RS01270 | 267593..268939 | + | 1347 | WP_017464655.1 | DEAD/DEAH box helicase | - |
| F1614_RS01275 | 268949..269839 | + | 891 | WP_002440064.1 | deoxyribonuclease IV | - |
| F1614_RS01280 | 270057..270839 | + | 783 | WP_002473684.1 | metal ABC transporter ATP-binding protein | - |
| F1614_RS01285 | 270873..271721 | + | 849 | WP_002476841.1 | metal ABC transporter permease | - |
| F1614_RS01290 | 271724..272143 | + | 420 | WP_002473590.1 | transcriptional repressor | - |
| F1614_RS01295 | 272556..273155 | + | 600 | WP_001831217.1 | superoxide dismutase | - |
| F1614_RS01300 | 273556..275643 | + | 2088 | WP_158171702.1 | penicillin-binding protein 2 | - |
| F1614_RS01305 | 275748..275897 | + | 150 | WP_001830957.1 | 50S ribosomal protein L33 | - |
| F1614_RS01310 | 276079..276630 | + | 552 | WP_017464657.1 | 5-formyltetrahydrofolate cyclo-ligase | - |
| F1614_RS01315 | 276631..278091 | + | 1461 | WP_002473602.1 | rhomboid family intramembrane serine protease | - |
| F1614_RS01320 | 278075..278275 | + | 201 | WP_002446537.1 | YqgQ family protein | - |
| F1614_RS01325 | 278275..279261 | + | 987 | WP_002473556.1 | ROK family glucokinase | - |
| F1614_RS01330 | 279261..279587 | + | 327 | WP_001831234.1 | MTH1187 family thiamine-binding protein | - |
| F1614_RS01335 | 279587..280210 | + | 624 | WP_002446535.1 | MBL fold metallo-hydrolase | - |
| F1614_RS01340 | 280267..281241 | + | 975 | WP_199253293.1 | Flp pilus assembly complex ATPase component TadA | - |
| F1614_RS01345 | 281213..282280 | + | 1068 | WP_158171704.1 | type II secretion system F family protein | - |
| F1614_RS01350 | 282298..282615 | + | 318 | WP_017464660.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
| F1614_RS01355 | 282605..283042 | + | 438 | WP_002473772.1 | hypothetical protein | - |
| F1614_RS01360 | 283029..283322 | + | 294 | WP_001831116.1 | hypothetical protein | - |
| F1614_RS01365 | 283246..283737 | + | 492 | WP_017464661.1 | competence protein ComGF | - |
| F1614_RS01370 | 283902..284414 | + | 513 | WP_002497929.1 | shikimate kinase | - |
| F1614_RS01375 | 284632..285723 | + | 1092 | WP_017464662.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| F1614_RS01380 | 285743..287089 | + | 1347 | WP_002473606.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| F1614_RS01385 | 287082..288590 | + | 1509 | WP_158171705.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
| F1614_RS01390 | 289042..289391 | + | 350 | Protein_262 | transposase | - |
| F1614_RS01395 | 289489..289875 | - | 387 | WP_001831303.1 | rhodanese-like domain-containing protein | - |
| F1614_RS01400 | 290035..290865 | + | 831 | WP_017464187.1 | lipoate--protein ligase family protein | - |
| F1614_RS01405 | 290906..291124 | - | 219 | WP_001831076.1 | hypothetical protein | - |
| F1614_RS01410 | 291138..291716 | - | 579 | WP_002476824.1 | hypothetical protein | - |
| F1614_RS01415 | 291819..292880 | + | 1062 | WP_017464189.1 | aminopeptidase P family protein | - |
| F1614_RS01420 | 292907..293464 | + | 558 | WP_001831269.1 | elongation factor P | - |
| F1614_RS01425 | 293614..294639 | + | 1026 | WP_002497923.1 | N-acetyl-gamma-glutamyl-phosphate reductase | - |
| F1614_RS01430 | 294658..295851 | + | 1194 | WP_002497922.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
| F1614_RS01435 | 295861..296601 | + | 741 | WP_158171706.1 | acetylglutamate kinase | - |
| F1614_RS01440 | 296598..297728 | + | 1131 | WP_029376538.1 | acetylornithine transaminase | - |
| F1614_RS01445 | 297986..298453 | + | 468 | WP_002497919.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein | - |
| F1614_RS01450 | 298453..299811 | + | 1359 | WP_002440022.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| F1614_RS01455 | 299823..300185 | + | 363 | WP_002440021.1 | Asp23/Gls24 family envelope stress response protein | - |
| F1614_RS01460 | 300261..300650 | + | 390 | WP_017464193.1 | transcription antitermination factor NusB | - |
| F1614_RS01465 | 300665..302002 | + | 1338 | WP_017464194.1 | exodeoxyribonuclease VII large subunit | - |
| F1614_RS01470 | 301995..302225 | + | 231 | WP_001830935.1 | exodeoxyribonuclease VII small subunit | - |
| F1614_RS01475 | 302203..303084 | + | 882 | WP_064205887.1 | polyprenyl synthetase family protein | - |
| F1614_RS01480 | 303398..303850 | + | 453 | WP_002456185.1 | transcriptional regulator ArgR | - |
| F1614_RS01485 | 303866..305542 | + | 1677 | WP_158171707.1 | DNA repair protein RecN | - |
| F1614_RS01490 | 305793..307214 | + | 1422 | WP_002497913.1 | dihydrolipoyl dehydrogenase | - |
| F1614_RS01495 | 307229..308227 | + | 999 | WP_002473642.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
| F1614_RS01500 | 308220..309203 | + | 984 | WP_158171708.1 | alpha-ketoacid dehydrogenase subunit beta | - |
| F1614_RS01505 | 309216..310535 | + | 1320 | WP_002473552.1 | 2-oxo acid dehydrogenase subunit E2 | - |
| F1614_RS01510 | 310739..311176 | + | 438 | WP_002497910.1 | BrxA/BrxB family bacilliredoxin | - |
| F1614_RS01515 | 311189..312166 | + | 978 | WP_002457709.1 | aromatic acid exporter family protein | - |
| F1614_RS01520 | 312218..312313 | - | 96 | WP_002493579.1 | stressosome-associated protein Prli42 | - |
| F1614_RS01525 | 312544..313668 | + | 1125 | WP_002493580.1 | M20/M25/M40 family metallo-hydrolase | - |
| F1614_RS01530 | 313748..315154 | + | 1407 | WP_002497907.1 | NADP-dependent phosphogluconate dehydrogenase | - |
| F1614_RS01535 | 315324..316979 | + | 1656 | WP_002493582.1 | alpha-glucosidase | - |
| F1614_RS01540 | 317242..318123 | - | 882 | WP_001831085.1 | AraC family transcriptional regulator | - |
| F1614_RS01550 | 318325..319809 | - | 1485 | WP_001831167.1 | glucose-6-phosphate dehydrogenase | - |
| F1614_RS01555 | 320233..321153 | + | 921 | WP_002476801.1 | ribonuclease Z | - |
| F1614_RS01560 | 321202..322017 | - | 816 | WP_158171709.1 | pyrroline-5-carboxylate reductase | - |
| F1614_RS01565 | 322178..322936 | + | 759 | WP_002493583.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| F1614_RS01570 | 323160..324068 | - | 909 | WP_017464198.1 | aldo/keto reductase | - |
| F1614_RS01575 | 324151..324693 | + | 543 | WP_017464199.1 | NUDIX hydrolase | - |
| F1614_RS01580 | 324798..325247 | + | 450 | WP_001831103.1 | transcriptional repressor | - |
| F1614_RS01585 | 325290..326177 | + | 888 | WP_001831286.1 | site-specific tyrosine recombinase XerD | - |
| F1614_RS01590 | 326230..326754 | - | 525 | WP_158171710.1 | DUF309 domain-containing protein | - |
| F1614_RS01595 | 326852..327583 | + | 732 | WP_001831064.1 | segregation/condensation protein A | - |
| F1614_RS01600 | 327576..328118 | + | 543 | WP_158171711.1 | SMC-Scp complex subunit ScpB | - |
| F1614_RS01605 | 328111..328848 | + | 738 | WP_001830978.1 | rRNA pseudouridine synthase | - |
| F1614_RS01610 | 328982..329707 | + | 726 | WP_002473738.1 | response regulator transcription factor | - |
| F1614_RS01615 | 329691..331451 | + | 1761 | WP_002473538.1 | HAMP domain-containing protein | - |
| F1614_RS01620 | 332037..332576 | + | 540 | WP_158171712.1 | ECF transporter S component | - |
| F1614_RS01630 | 332981..333229 | - | 249 | WP_001831262.1 | ferredoxin | - |
| F1614_RS01635 | 333338..334300 | + | 963 | WP_017464201.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS01640 | 334287..335666 | + | 1380 | WP_017464202.1 | ATP-dependent DNA helicase | - |
| F1614_RS01645 | 335823..337205 | + | 1383 | WP_153000756.1 | elastin-binding protein EbpS | - |
| F1614_RS01650 | 337338..338324 | + | 987 | WP_002473578.1 | YpdA family putative bacillithiol disulfide reductase | - |
| F1614_RS01655 | 338536..339504 | - | 969 | WP_158171713.1 | asparaginase | - |
| F1614_RS01660 | 339583..340230 | + | 648 | WP_002493590.1 | (d)CMP kinase | - |
| F1614_RS01665 | 340714..341892 | + | 1179 | WP_017464203.1 | 30S ribosomal protein S1 | - |
| F1614_RS01670 | 342108..343418 | + | 1311 | WP_002476786.1 | ribosome biogenesis GTPase Der | - |
| F1614_RS01675 | 343439..344437 | + | 999 | WP_017464204.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| F1614_RS01680 | 344608..344880 | + | 273 | WP_001043863.1 | HU family DNA-binding protein | - |
| F1614_RS01685 | 345351..345929 | + | 579 | WP_002493593.1 | hypothetical protein | - |
| F1614_RS01690 | 345922..346647 | + | 726 | WP_001831089.1 | demethylmenaquinone methyltransferase | - |
| F1614_RS01695 | 346649..347608 | + | 960 | WP_002473613.1 | polyprenyl synthetase family protein | - |
| F1614_RS01700 | 347748..348197 | + | 450 | WP_001831235.1 | nucleoside-diphosphate kinase | - |
| F1614_RS01705 | 348678..349844 | + | 1167 | WP_001831020.1 | chorismate synthase | - |
| F1614_RS01710 | 349872..350936 | + | 1065 | WP_017464205.1 | 3-dehydroquinate synthase | - |
| F1614_RS01715 | 350946..352247 | + | 1302 | WP_002497895.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| F1614_RS01720 | 352251..353495 | + | 1245 | WP_017464206.1 | tetratricopeptide repeat protein | - |
| F1614_RS01725 | 353509..354072 | + | 564 | WP_158171714.1 | YpiB family protein | - |
| F1614_RS01730 | 354084..354677 | + | 594 | WP_002476776.1 | DUF1405 domain-containing protein | - |
| F1614_RS01735 | 354722..355417 | + | 696 | WP_001831045.1 | zinc metallopeptidase | - |
| F1614_RS01740 | 355598..355915 | + | 318 | WP_017464209.1 | nucleotide pyrophosphohydrolase | - |
| F1614_RS01745 | 355937..357079 | + | 1143 | WP_002473561.1 | N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA | - |
| F1614_RS01750 | 357069..358271 | + | 1203 | WP_002476774.1 | CCA tRNA nucleotidyltransferase | - |
| F1614_RS01755 | 358258..359229 | + | 972 | WP_158171715.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| F1614_RS01760 | 359254..361962 | + | 2709 | WP_158171716.1 | 3'-5' exoribonuclease | - |
| F1614_RS01765 | 362083..363375 | + | 1293 | WP_002473721.1 | asparagine--tRNA ligase | - |
| F1614_RS01770 | 363469..364155 | + | 687 | WP_002476771.1 | DnaD domain-containing protein | - |
| F1614_RS01775 | 364145..364804 | + | 660 | WP_001831179.1 | endonuclease III | - |
| F1614_RS01780 | 364809..365141 | + | 333 | WP_002473655.1 | hypothetical protein | - |
| F1614_RS01785 | 365327..367561 | - | 2235 | WP_158171717.1 | penicillin-binding protein | - |
| F1614_RS01790 | 367558..368184 | - | 627 | WP_002476769.1 | Holliday junction resolvase RecU | - |
| F1614_RS01795 | 368528..368860 | + | 333 | WP_002467704.1 | YppE family protein | - |
| F1614_RS01800 | 368872..369438 | + | 567 | WP_017464212.1 | DUF1273 domain-containing protein | - |
| F1614_RS01805 | 369452..369790 | + | 339 | WP_001831034.1 | cell division regulator GpsB | - |
| F1614_RS01815 | 370432..371568 | + | 1137 | WP_002439767.1 | class I SAM-dependent RNA methyltransferase | - |
| F1614_RS01820 | 371736..372374 | + | 639 | WP_001831317.1 | SDR family oxidoreductase | - |
| F1614_RS01825 | 372752..376189 | + | 3438 | WP_158171718.1 | dynamin family protein | - |
| F1614_RS01830 | 376208..377086 | + | 879 | WP_158171719.1 | 5'-3' exonuclease | - |
| F1614_RS01840 | 377428..407882 | + | 30455 | Protein_348 | hyperosmolarity resistance protein Ebh | - |
| F1614_RS01845 | 408055..408450 | - | 396 | WP_002467711.1 | ribonuclease HI family protein | - |
| F1614_RS01850 | 408775..409479 | - | 705 | WP_001831106.1 | queuosine precursor transporter | - |
| F1614_RS01855 | 409730..409924 | + | 195 | WP_001831026.1 | zinc-finger domain-containing protein | - |
| F1614_RS01860 | 409936..410196 | + | 261 | WP_001831110.1 | NifU N-terminal domain-containing protein | - |
| F1614_RS01865 | 410248..410685 | + | 438 | WP_017464214.1 | BrxA/BrxB family bacilliredoxin | - |
| F1614_RS01870 | 410898..411947 | + | 1050 | WP_059279834.1 | ABC transporter permease | - |
| F1614_RS01875 | 411963..412625 | + | 663 | WP_001832777.1 | ABC transporter ATP-binding protein | - |
| F1614_RS01880 | 412946..413902 | + | 957 | WP_002473572.1 | thymidylate synthase | - |
| F1614_RS01885 | 413944..414429 | + | 486 | WP_158171720.1 | trimethoprim-resistant dihydrofolate reductase DfrC | - |
| F1614_RS01890 | 414439..415287 | + | 849 | WP_158171721.1 | fatty acid kinase binding subunit FakB2 | - |
| F1614_RS01895 | 415390..415917 | + | 528 | WP_002473680.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
| F1614_RS01900 | 415910..416338 | + | 429 | WP_002439748.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| F1614_RS01905 | 416351..416851 | + | 501 | WP_001831133.1 | PTS glucose transporter subunit IIA | - |
| F1614_RS01910 | 416851..417075 | + | 225 | WP_158171722.1 | YozE family protein | - |
| F1614_RS01915 | 417420..418895 | + | 1476 | WP_158171723.1 | S41 family peptidase | - |
| F1614_RS01925 | 419231..419734 | + | 504 | WP_002446437.1 | GNAT family N-acetyltransferase | - |
| F1614_RS01930 | 419752..420825 | + | 1074 | WP_002467698.1 | undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | - |
| F1614_RS01935 | 420838..421452 | + | 615 | WP_017464217.1 | phosphatase PAP2 family protein | - |
| F1614_RS01940 | 421803..422894 | + | 1092 | WP_017464218.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| F1614_RS01945 | 422891..423847 | + | 957 | WP_017464219.1 | sugar ABC transporter permease | - |
| F1614_RS01950 | 423859..425547 | + | 1689 | WP_017464220.1 | extracellular solute-binding protein | - |
| F1614_RS01955 | 425563..426459 | + | 897 | WP_002493619.1 | carbohydrate ABC transporter permease | - |
| F1614_RS01960 | 426473..427327 | + | 855 | WP_158171724.1 | metallophosphoesterase family protein | - |
| F1614_RS01965 | 427314..428639 | + | 1326 | WP_017464221.1 | MATE family efflux transporter | - |
| F1614_RS01970 | 428646..429413 | + | 768 | WP_002446428.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| F1614_RS01980 | 429971..430630 | + | 660 | WP_001830971.1 | response regulator transcription factor | - |
| F1614_RS01985 | 430627..431997 | + | 1371 | WP_002497866.1 | HAMP domain-containing histidine kinase | - |
| F1614_RS01995 | 432402..435206 | + | 2805 | WP_017464223.1 | 2-oxoglutarate dehydrogenase E1 component | - |
| F1614_RS02000 | 435224..436486 | + | 1263 | WP_017464224.1 | dihydrolipoyllysine-residue succinyltransferase | - |
| F1614_RS02005 | 436651..436824 | - | 174 | WP_002439720.1 | hypothetical protein | - |
| F1614_RS02010 | 437025..437834 | + | 810 | WP_017464225.1 | VOC family protein | - |
| F1614_RS02015 | 437859..438062 | + | 204 | WP_001831030.1 | hypothetical protein | - |
| F1614_RS02020 | 438240..439031 | + | 792 | WP_002473573.1 | MoxR family ATPase | - |
| F1614_RS02025 | 439044..440933 | + | 1890 | WP_017464226.1 | VWA domain-containing protein | - |
| F1614_RS02030 | 441120..442463 | + | 1344 | WP_017464227.1 | branched-chain amino acid transport system II carrier protein | - |
| F1614_RS02035 | 442539..443669 | - | 1131 | WP_002497859.1 | toxic anion resistance protein | - |
| F1614_RS02040 | 443692..444318 | - | 627 | WP_002476740.1 | 5-bromo-4-chloroindolyl phosphate hydrolysis family protein | - |
| F1614_RS02045 | 444358..444627 | - | 270 | WP_002473673.1 | acylphosphatase | - |
| F1614_RS02050 | 444786..445094 | + | 309 | WP_002473588.1 | regulatory protein MsaA | - |
| F1614_RS02055 | 445275..445475 | + | 201 | WP_001831260.1 | cold shock protein CspA | - |
| F1614_RS02060 | 445834..446415 | + | 582 | WP_158171725.1 | CPBP family intramembrane metalloprotease | - |
| F1614_RS02065 | 446421..446831 | + | 411 | WP_017464228.1 | Msa family membrane protein | - |
| F1614_RS02070 | 446818..447681 | + | 864 | WP_017464229.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS02075 | 447690..448439 | + | 750 | WP_017464230.1 | ABC transporter permease | - |
| F1614_RS02080 | 448571..449836 | - | 1266 | WP_017464231.1 | diaminopimelate decarboxylase | - |
| F1614_RS02085 | 449837..450910 | - | 1074 | WP_017464232.1 | alanine racemase | - |
| F1614_RS02090 | 450916..452067 | - | 1152 | WP_017464233.1 | amidohydrolase | - |
| F1614_RS02095 | 452225..452947 | - | 723 | WP_001830955.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | - |
| F1614_RS02100 | 452969..453691 | - | 723 | WP_002473529.1 | 4-hydroxy-tetrahydrodipicolinate reductase | - |
| F1614_RS02105 | 453691..454575 | - | 885 | WP_002473634.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| F1614_RS02110 | 454577..455566 | - | 990 | WP_002473708.1 | aspartate-semialdehyde dehydrogenase | - |
| F1614_RS02115 | 455637..456869 | - | 1233 | WP_158171726.1 | aspartate kinase | - |
| F1614_RS02120 | 457447..459054 | - | 1608 | WP_001830940.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS02125 | 459268..460164 | + | 897 | WP_017464234.1 | RNA-binding virulence regulatory protein CvfB | - |
| F1614_RS02130 | 460768..461745 | + | 978 | WP_002446401.1 | PstS family phosphate ABC transporter substrate-binding protein | - |
| F1614_RS02135 | 461952..462878 | + | 927 | WP_001830936.1 | phosphate ABC transporter permease subunit PstC | - |
| F1614_RS02140 | 462880..463785 | + | 906 | WP_002473764.1 | phosphate ABC transporter permease PstA | - |
| F1614_RS02145 | 463873..464748 | + | 876 | WP_001831097.1 | phosphate ABC transporter ATP-binding protein | - |
| F1614_RS02150 | 464755..465402 | + | 648 | WP_001830968.1 | phosphate signaling complex protein PhoU | - |
| F1614_RS02155 | 465495..467306 | - | 1812 | WP_158171727.1 | oligoendopeptidase F | - |
| F1614_RS02160 | 467554..467892 | + | 339 | WP_002439678.1 | membrane protein | - |
| F1614_RS02165 | 468071..469072 | + | 1002 | WP_002497849.1 | ABC transporter permease | - |
| F1614_RS02170 | 469062..469916 | + | 855 | WP_158171728.1 | ABC transporter permease | - |
| F1614_RS02175 | 469879..470655 | + | 777 | WP_002473654.1 | ABC transporter ATP-binding protein | - |
| F1614_RS02180 | 470658..471353 | + | 696 | WP_002473745.1 | dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein | - |
| F1614_RS02185 | 471483..472493 | - | 1011 | WP_002497846.1 | ABC transporter substrate-binding protein | - |
| F1614_RS02190 | 472558..473322 | - | 765 | WP_002497845.1 | HAD-IIB family hydrolase | - |
| F1614_RS02195 | 474324..475577 | - | 1254 | WP_158171729.1 | aminoacyltransferase | - |
| F1614_RS02200 | 475603..476856 | - | 1254 | WP_002476719.1 | aminoacyltransferase | - |
| F1614_RS02210 | 477129..477788 | - | 660 | WP_017464237.1 | DJ-1/PfpI family protein | - |
| F1614_RS02215 | 477979..478710 | - | 732 | WP_002456200.1 | tryptophan synthase subunit alpha | - |
| F1614_RS02220 | 478703..479911 | - | 1209 | WP_158171730.1 | tryptophan synthase subunit beta | - |
| F1614_RS02225 | 479915..480538 | - | 624 | WP_017464239.1 | phosphoribosylanthranilate isomerase | - |
| F1614_RS02230 | 480528..481316 | - | 789 | WP_059279838.1 | indole-3-glycerol phosphate synthase TrpC | - |
| F1614_RS02235 | 481320..482315 | - | 996 | WP_002473566.1 | anthranilate phosphoribosyltransferase | - |
| F1614_RS02240 | 482318..482884 | - | 567 | WP_002473754.1 | aminodeoxychorismate/anthranilate synthase component II | - |
| F1614_RS02245 | 482881..484287 | - | 1407 | WP_059279839.1 | anthranilate synthase component I | - |
| F1614_RS02250 | 484946..486034 | + | 1089 | WP_059279840.1 | prephenate dehydrogenase | - |
| F1614_RS02255 | 486108..487370 | - | 1263 | WP_002473757.1 | Y-family DNA polymerase | - |
| F1614_RS02260 | 487514..487699 | + | 186 | WP_001831035.1 | 4-oxalocrotonate tautomerase | - |
| F1614_RS02265 | 487762..488751 | - | 990 | WP_001831067.1 | LCP family protein | - |
| F1614_RS02270 | 488887..489402 | + | 516 | WP_002473735.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
| F1614_RS02275 | 489596..492118 | - | 2523 | WP_017464243.1 | bifunctional lysylphosphatidylglycerol flippase/synthetase MprF | - |
| F1614_RS02280 | 492372..493589 | - | 1218 | WP_002446374.1 | AI-2E family transporter | - |
| F1614_RS02285 | 493736..494584 | - | 849 | WP_002456203.1 | transcription antiterminator | - |
| F1614_RS02290 | 494772..496235 | - | 1464 | WP_002493654.1 | alanine:cation symporter family protein | - |
| F1614_RS02295 | 496447..498849 | - | 2403 | WP_017464244.1 | DNA topoisomerase IV subunit A | - |
| F1614_RS02300 | 498846..500840 | - | 1995 | WP_199253300.1 | DNA topoisomerase IV subunit B | - |
| F1614_RS02305 | 501050..501658 | + | 609 | WP_002497833.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
| F1614_RS02310 | 501903..502199 | + | 297 | WP_017464245.1 | hypothetical protein | - |
| F1614_RS02315 | 502260..502727 | - | 468 | WP_002476703.1 | acyl-CoA thioesterase | - |
| F1614_RS02320 | 502850..505555 | - | 2706 | WP_017464246.1 | aconitate hydratase AcnA | - |
| F1614_RS02325 | 505977..507617 | - | 1641 | WP_017464247.1 | BCCT family transporter | - |
| F1614_RS02330 | 507829..508179 | + | 351 | WP_002473678.1 | large conductance mechanosensitive channel protein MscL | - |
| F1614_RS02335 | 508298..511327 | - | 3030 | WP_017464248.1 | SMC family ATPase | - |
| F1614_RS02340 | 511331..512455 | - | 1125 | WP_002470453.1 | exonuclease SbcCD subunit D | - |
| F1614_RS02345 | 512563..513030 | - | 468 | WP_001831312.1 | DUF1453 family protein | - |
| F1614_RS02350 | 513261..513488 | - | 228 | WP_001831215.1 | YneF family protein | - |
| F1614_RS02355 | 513695..515683 | - | 1989 | WP_158171732.1 | transketolase | - |
| F1614_RS02360 | 515914..516150 | - | 237 | WP_002470444.1 | DUF896 domain-containing protein | - |
| F1614_RS02365 | 516311..516544 | - | 234 | WP_002476697.1 | hypothetical protein | - |
| F1614_RS02370 | 516688..517308 | + | 621 | WP_001831182.1 | transcriptional repressor LexA | - |
| F1614_RS02380 | 517661..518686 | - | 1026 | WP_017464251.1 | CAP domain-containing protein | - |
| F1614_RS02385 | 518700..519677 | - | 978 | WP_002473667.1 | GMP reductase | - |
| F1614_RS02390 | 519831..520100 | - | 270 | WP_001831302.1 | 30S ribosomal protein S14 | - |
| F1614_RS02395 | 520266..520415 | - | 150 | WP_001831295.1 | 50S ribosomal protein L33 | - |
| F1614_RS02400 | 520505..522019 | - | 1515 | WP_017464252.1 | catalase | - |
| F1614_RS02405 | 522250..523698 | + | 1449 | WP_158171733.1 | amino acid permease | - |
| F1614_RS02410 | 524004..524318 | + | 315 | WP_002439628.1 | hypothetical protein | - |
| F1614_RS02415 | 524650..525456 | - | 807 | WP_059279843.1 | Cof-type HAD-IIB family hydrolase | - |
| F1614_RS02420 | 525519..526439 | - | 921 | WP_017464255.1 | homoserine kinase | - |
| F1614_RS02425 | 526441..527505 | - | 1065 | WP_017464256.1 | threonine synthase | - |
| F1614_RS02430 | 527511..528791 | - | 1281 | WP_017464257.1 | homoserine dehydrogenase | - |
| F1614_RS02435 | 528980..530356 | + | 1377 | WP_017464258.1 | aspartate kinase | - |
| F1614_RS02440 | 530434..531033 | - | 600 | WP_017464259.1 | hypothetical protein | - |
| F1614_RS02445 | 531360..532232 | + | 873 | WP_002494829.1 | hypothetical protein | - |
| F1614_RS02450 | 532968..533504 | - | 537 | WP_002494828.1 | thermonuclease family protein | - |
| F1614_RS02455 | 533669..533857 | + | 189 | WP_001829458.1 | membrane protein | - |
| F1614_RS02460 | 534026..534629 | - | 604 | Protein_467 | response regulator transcription factor | - |
| F1614_RS02465 | 534626..535720 | - | 1095 | WP_158171734.1 | sensor histidine kinase | - |
| F1614_RS02470 | 535720..536451 | - | 732 | WP_059279844.1 | ABC transporter permease | - |
| F1614_RS02475 | 536448..537323 | - | 876 | WP_002493675.1 | ABC transporter ATP-binding protein | - |
| F1614_RS02480 | 537501..538973 | - | 1473 | WP_002493676.1 | cardiolipin synthase | - |
| F1614_RS02485 | 539031..539228 | - | 198 | WP_001829481.1 | hypothetical protein | - |
| F1614_RS02490 | 539542..540567 | + | 1026 | WP_002456217.1 | low specificity L-threonine aldolase | - |
| F1614_RS02495 | 540637..541320 | + | 684 | WP_017464263.1 | Ltp family lipoprotein | - |
| F1614_RS02500 | 541570..542118 | - | 549 | Protein_475 | DUF4355 domain-containing protein | - |
| F1614_RS02505 | 542257..542466 | - | 210 | WP_002433602.1 | hypothetical protein | - |
| F1614_RS02510 | 542466..543560 | - | 1095 | Protein_477 | minor capsid protein | - |
| F1614_RS02515 | 543785..545125 | - | 1341 | WP_001829492.1 | type I glutamate--ammonia ligase | - |
| F1614_RS02520 | 545144..545509 | - | 366 | WP_002473611.1 | MerR family transcriptional regulator | - |
| F1614_RS02525 | 545989..547227 | - | 1239 | WP_158171735.1 | methionine gamma-lyase family protein | - |
| F1614_RS02530 | 547243..548483 | - | 1241 | Protein_481 | GTPase HflX | - |
| F1614_RS02535 | 548593..549069 | + | 477 | WP_002473601.1 | glutathione peroxidase | - |
| F1614_RS02540 | 549290..549529 | - | 240 | WP_002473703.1 | RNA chaperone Hfq | - |
| F1614_RS02545 | 549483..550481 | - | 999 | WP_017464267.1 | tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA | - |
| F1614_RS02550 | 550493..551419 | - | 927 | WP_136626762.1 | alpha/beta hydrolase | - |
| F1614_RS02555 | 551642..553315 | - | 1674 | WP_002473549.1 | glycerol-3-phosphate dehydrogenase/oxidase | - |
| F1614_RS02560 | 553492..554991 | - | 1500 | WP_002476673.1 | glycerol kinase GlpK | - |
| F1614_RS02565 | 555145..555969 | - | 825 | WP_017464269.1 | aquaporin family protein | - |
| F1614_RS02570 | 556344..556877 | - | 534 | WP_001829471.1 | glycerol-3-phosphate responsive antiterminator | - |
| F1614_RS02575 | 556891..558828 | - | 1938 | WP_017464270.1 | DNA mismatch repair endonuclease MutL | - |
| F1614_RS02580 | 558843..561464 | - | 2622 | WP_017464271.1 | DNA mismatch repair protein MutS | - |
| F1614_RS02585 | 561662..562156 | - | 495 | WP_001829480.1 | energy coupling factor transporter S component ThiW | - |
| F1614_RS02590 | 562180..562545 | - | 366 | WP_002439569.1 | RicAFT regulatory complex protein RicA family protein | - |
| F1614_RS02595 | 562547..564091 | - | 1545 | WP_002473612.1 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | - |
| F1614_RS02600 | 564434..564724 | - | 291 | WP_151521300.1 | MTH1187 family thiamine-binding protein | - |
| F1614_RS02605 | 564781..565398 | - | 618 | WP_001832558.1 | poly-gamma-glutamate hydrolase family protein | - |
| F1614_RS02610 | 565985..566851 | - | 867 | WP_002439562.1 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | - |
| F1614_RS02615 | 566852..568612 | - | 1761 | WP_158171737.1 | 2-oxoacid:acceptor oxidoreductase subunit alpha | - |
| F1614_RS02620 | 568725..569519 | - | 795 | WP_002470239.1 | TIGR00282 family metallophosphoesterase | - |
| F1614_RS02625 | 569683..569898 | + | 216 | WP_002439555.1 | hypothetical protein | - |
| F1614_RS02630 | 569988..571547 | - | 1560 | WP_001829512.1 | ribonuclease Y | - |
| F1614_RS02635 | 571773..572816 | - | 1044 | WP_002487418.1 | recombinase RecA | - |
| F1614_RS02640 | 572987..574132 | - | 1146 | WP_158171738.1 | CinA family nicotinamide mononucleotide deamidase-related protein | - |
| F1614_RS02650 | 575095..575676 | - | 582 | WP_002468559.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| F1614_RS02655 | 575705..576097 | - | 393 | WP_001832565.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS02660 | 576116..576943 | - | 828 | WP_002456562.1 | YmfK family protein | - |
| F1614_RS02665 | 577096..577800 | - | 705 | WP_002473832.1 | SDR family oxidoreductase | - |
| F1614_RS02670 | 577797..579086 | - | 1290 | WP_017464333.1 | insulinase family protein | - |
| F1614_RS02675 | 579086..580357 | - | 1272 | WP_002468568.1 | insulinase family protein | - |
| F1614_RS02680 | 580387..581100 | - | 714 | WP_002439536.1 | GntR family transcriptional regulator | - |
| F1614_RS02685 | 581103..583496 | - | 2394 | WP_002439534.1 | DNA translocase FtsK | - |
| F1614_RS02690 | 583762..585435 | - | 1674 | WP_158171739.1 | ribonuclease J | - |
| F1614_RS02695 | 585803..587908 | - | 2106 | WP_002468566.1 | polyribonucleotide nucleotidyltransferase | - |
| F1614_RS02700 | 588040..588309 | - | 270 | WP_002439528.1 | 30S ribosomal protein S15 | - |
| F1614_RS02705 | 588429..589400 | - | 972 | WP_001832563.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| F1614_RS02710 | 589416..590333 | - | 918 | WP_017464330.1 | tRNA pseudouridine(55) synthase TruB | - |
| F1614_RS02715 | 590471..590821 | - | 351 | WP_158171740.1 | 30S ribosome-binding factor RbfA | - |
| F1614_RS02720 | 591122..593284 | - | 2163 | WP_017464329.1 | translation initiation factor IF-2 | - |
| F1614_RS02725 | 593289..593606 | - | 318 | WP_002439520.1 | YlxQ family RNA-binding protein | - |
| F1614_RS02730 | 593606..593890 | - | 285 | WP_002468555.1 | YlxR family protein | - |
| F1614_RS02735 | 593908..595131 | - | 1224 | WP_017464328.1 | transcription termination/antitermination protein NusA | - |
| F1614_RS02740 | 595152..595619 | - | 468 | WP_002473841.1 | ribosome maturation factor RimP | - |
| F1614_RS02745 | 595799..600109 | - | 4311 | WP_158171978.1 | PolC-type DNA polymerase III | - |
| F1614_RS02750 | 600359..602062 | - | 1704 | WP_017464327.1 | proline--tRNA ligase | - |
| F1614_RS02755 | 602081..603367 | - | 1287 | WP_001829501.1 | RIP metalloprotease RseP | - |
| F1614_RS02760 | 603601..604383 | - | 783 | WP_001829499.1 | phosphatidate cytidylyltransferase | - |
| F1614_RS02765 | 604387..605157 | - | 771 | WP_002468551.1 | isoprenyl transferase | - |
| F1614_RS02770 | 605378..605932 | - | 555 | WP_002468545.1 | ribosome recycling factor | - |
| F1614_RS02775 | 605949..606671 | - | 723 | WP_002439511.1 | UMP kinase | - |
| F1614_RS02780 | 606812..607690 | - | 879 | WP_002439509.1 | elongation factor Ts | - |
| F1614_RS02785 | 607842..608630 | - | 789 | WP_001832557.1 | 30S ribosomal protein S2 | - |
| F1614_RS02790 | 608989..609762 | - | 774 | WP_002446289.1 | GTP-sensing pleiotropic transcriptional regulator CodY | - |
| F1614_RS02795 | 609786..611189 | - | 1404 | WP_001829474.1 | ATP-dependent protease ATPase subunit HslU | - |
| F1614_RS02800 | 611258..611800 | - | 543 | WP_001829498.1 | ATP-dependent protease subunit HslV | - |
| F1614_RS02805 | 611804..612694 | - | 891 | WP_017464326.1 | tyrosine recombinase XerC | - |
| F1614_RS02810 | 612919..614226 | - | 1308 | WP_002473845.1 | FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO | - |
| F1614_RS02815 | 614251..616320 | - | 2070 | WP_158171741.1 | type I DNA topoisomerase | - |
| F1614_RS02820 | 616503..617375 | - | 873 | WP_017464325.1 | DNA-processing protein DprA | - |
| F1614_RS02825 | 618099..619007 | - | 909 | WP_002446283.1 | succinate--CoA ligase subunit alpha | - |
| F1614_RS02830 | 619029..620195 | - | 1167 | WP_017464324.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| F1614_RS02835 | 620303..621073 | - | 771 | WP_002498365.1 | ribonuclease HII | - |
| F1614_RS02840 | 621078..621941 | - | 864 | WP_158171742.1 | ribosome biogenesis GTPase YlqF | - |
| F1614_RS02850 | 622270..624870 | + | 2601 | WP_017464323.1 | YfhO family protein | - |
| F1614_RS02855 | 624863..627466 | + | 2604 | WP_059279849.1 | YfhO family protein | - |
| F1614_RS02860 | 628019..628369 | - | 351 | WP_002436293.1 | 50S ribosomal protein L19 | - |
| F1614_RS02865 | 628475..629212 | - | 738 | WP_017464321.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| F1614_RS02870 | 629212..629715 | - | 504 | WP_002473837.1 | ribosome maturation factor RimM | - |
| F1614_RS02875 | 629842..630117 | - | 276 | WP_002439483.1 | 30S ribosomal protein S16 | - |
| F1614_RS02880 | 630363..631730 | - | 1368 | WP_001830113.1 | signal recognition particle protein | - |
| F1614_RS02885 | 631761..632093 | - | 333 | WP_002457379.1 | putative DNA-binding protein | - |
| F1614_RS02890 | 632095..633321 | - | 1227 | WP_017464320.1 | signal recognition particle-docking protein FtsY | - |
| F1614_RS02895 | 633318..636887 | - | 3570 | WP_059279850.1 | chromosome segregation protein SMC | - |
| F1614_RS02900 | 637014..637751 | - | 738 | WP_002498371.1 | ribonuclease III | - |
| F1614_RS02905 | 637866..638099 | - | 234 | WP_001830184.1 | acyl carrier protein | - |
| F1614_RS02910 | 638296..639030 | - | 735 | WP_001830161.1 | 3-oxoacyl-[acyl-carrier-protein] reductase | - |
| F1614_RS02915 | 639023..639949 | - | 927 | WP_002473278.1 | ACP S-malonyltransferase | - |
| F1614_RS02920 | 639951..640928 | - | 978 | WP_002469384.1 | phosphate acyltransferase PlsX | - |
| F1614_RS02925 | 640930..641490 | - | 561 | WP_001830099.1 | transcription factor FapR | - |
| F1614_RS02930 | 641649..643697 | - | 2049 | WP_017464318.1 | ATP-dependent DNA helicase RecG | - |
| F1614_RS02935 | 643902..645560 | - | 1659 | WP_017464317.1 | fatty acid kinase catalytic subunit FakA | - |
| F1614_RS02940 | 645575..645949 | - | 375 | WP_001830156.1 | Asp23/Gls24 family envelope stress response protein | - |
| F1614_RS02945 | 646307..646495 | + | 189 | WP_001830107.1 | 50S ribosomal protein L28 | - |
| F1614_RS02950 | 646578..647213 | - | 636 | WP_002498376.1 | thiamine diphosphokinase | - |
| F1614_RS02955 | 647218..647862 | - | 645 | WP_059279851.1 | ribulose-phosphate 3-epimerase | - |
| F1614_RS02960 | 647863..648738 | - | 876 | WP_001830137.1 | ribosome small subunit-dependent GTPase A | - |
| F1614_RS02965 | 649046..651049 | - | 2004 | WP_002473297.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| F1614_RS02970 | 651046..651789 | - | 744 | WP_002473245.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| F1614_RS02975 | 651796..652890 | - | 1095 | WP_002473267.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| F1614_RS02980 | 652893..654200 | - | 1308 | WP_002473236.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| F1614_RS02985 | 654197..655129 | - | 933 | WP_002498381.1 | methionyl-tRNA formyltransferase | - |
| F1614_RS02990 | 655122..655610 | - | 489 | WP_002473246.1 | peptide deformylase | - |
| F1614_RS02995 | 655832..656035 | + | 204 | WP_001830141.1 | TM2 domain-containing protein | - |
| F1614_RS03000 | 656142..658550 | - | 2409 | WP_158171743.1 | primosomal protein N' | - |
| F1614_RS03005 | 658550..659749 | - | 1200 | WP_017464314.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
| F1614_RS03010 | 660288..660500 | - | 213 | WP_002439449.1 | DNA-directed RNA polymerase subunit omega | - |
| F1614_RS03015 | 660500..661123 | - | 624 | WP_001830096.1 | guanylate kinase | - |
| F1614_RS03020 | 661393..663090 | + | 1698 | WP_158171744.1 | NFACT family protein | - |
| F1614_RS03025 | 663152..663559 | - | 408 | WP_017464312.1 | VOC family protein | - |
| F1614_RS03030 | 664099..664305 | - | 207 | WP_002473248.1 | hypothetical protein | - |
| F1614_RS03035 | 664331..664942 | - | 612 | WP_002473291.1 | orotate phosphoribosyltransferase | - |
| F1614_RS03040 | 664943..665635 | - | 693 | WP_002469379.1 | orotidine-5'-phosphate decarboxylase | - |
| F1614_RS03045 | 665670..668843 | - | 3174 | WP_017464310.1 | carbamoyl-phosphate synthase large subunit | - |
| F1614_RS03050 | 668836..669936 | - | 1101 | WP_158171745.1 | carbamoyl phosphate synthase small subunit | - |
| F1614_RS03055 | 669937..671214 | - | 1278 | WP_017464309.1 | dihydroorotase | - |
| F1614_RS03060 | 671232..672113 | - | 882 | WP_158171746.1 | aspartate carbamoyltransferase catalytic subunit | - |
| F1614_RS03065 | 672139..673446 | - | 1308 | WP_017464308.1 | NCS2 family nucleobase:cation symporter | - |
| F1614_RS03070 | 673679..674206 | - | 528 | WP_002446241.1 | bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR | - |
| F1614_RS03075 | 674509..675426 | - | 918 | WP_002473255.1 | RluA family pseudouridine synthase | - |
| F1614_RS03080 | 675429..675914 | - | 486 | WP_002494957.1 | signal peptidase II | - |
| F1614_RS03085 | 676003..676473 | - | 471 | WP_017464307.1 | CHAP domain-containing protein | - |
| F1614_RS03090 | 676478..677275 | - | 798 | WP_017464306.1 | VOC family protein | - |
| F1614_RS03095 | 678033..680783 | - | 2751 | WP_158171747.1 | isoleucine--tRNA ligase | - |
| F1614_RS03100 | 681098..681754 | - | 657 | WP_059279856.1 | DivIVA domain-containing protein | - |
| F1614_RS03105 | 681777..682553 | - | 777 | WP_049368472.1 | RNA-binding protein | - |
| F1614_RS03110 | 682694..682984 | - | 291 | WP_001830086.1 | YggT family protein | - |
| F1614_RS03115 | 682996..683589 | - | 594 | WP_158171748.1 | cell division protein SepF | - |
| F1614_RS03120 | 683603..684271 | - | 669 | WP_002476620.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
| F1614_RS03125 | 684297..685088 | - | 792 | WP_017464304.1 | peptidoglycan editing factor PgeF | - |
| F1614_RS03130 | 685505..686689 | - | 1185 | WP_017464303.1 | cell division protein FtsZ | - |
| F1614_RS03135 | 686722..688116 | - | 1395 | WP_002456594.1 | cell division protein FtsA | - |
| F1614_RS03140 | 688222..689613 | - | 1392 | WP_059279857.1 | FtsQ-type POTRA domain-containing protein | - |
| F1614_RS03145 | 689629..690978 | - | 1350 | WP_017464300.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| F1614_RS03150 | 690980..691945 | - | 966 | WP_002446226.1 | phospho-N-acetylmuramoyl-pentapeptide- transferase | - |
| F1614_RS03155 | 692134..694461 | - | 2328 | WP_158171749.1 | PASTA domain-containing protein | - |
| F1614_RS03160 | 694442..694843 | - | 402 | WP_002446224.1 | cell division protein FtsL | - |
| F1614_RS03165 | 694856..695791 | - | 936 | WP_001830134.1 | 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH | - |
| F1614_RS03170 | 695806..696237 | - | 432 | WP_001830185.1 | division/cell wall cluster transcriptional repressor MraZ | - |
| F1614_RS03175 | 696381..697994 | - | 1614 | WP_017464298.1 | bacillithiol biosynthesis cysteine-adding enzyme BshC | - |
| F1614_RS03180 | 698178..698618 | + | 441 | WP_017464297.1 | N-acetyltransferase | - |
| F1614_RS03185 | 698727..699413 | - | 687 | WP_002473249.1 | YjjG family noncanonical pyrimidine nucleotidase | - |
| F1614_RS03190 | 699520..699654 | - | 135 | WP_001830095.1 | beta-class phenol-soluble modulin | - |
| F1614_RS03195 | 699706..699840 | - | 135 | WP_002446218.1 | beta-class phenol-soluble modulin | - |
| F1614_RS03200 | 699896..700027 | - | 132 | WP_001830076.1 | beta-class phenol-soluble modulin | - |
| F1614_RS03210 | 700798..701340 | - | 543 | WP_017464296.1 | hypothetical protein | - |
| F1614_RS03215 | 702068..702577 | - | 510 | WP_002494817.1 | metallophosphoesterase | - |
| F1614_RS03220 | 702570..703157 | - | 588 | WP_017464295.1 | XTP/dITP diphosphatase | - |
| F1614_RS03225 | 703172..703975 | - | 804 | WP_002473281.1 | glutamate racemase | - |
| F1614_RS03230 | 704138..704980 | - | 843 | WP_017464293.1 | succinate dehydrogenase iron-sulfur subunit | - |
| F1614_RS03235 | 704980..706746 | - | 1767 | WP_017464292.1 | succinate dehydrogenase flavoprotein subunit | - |
| F1614_RS03240 | 706899..707513 | - | 615 | WP_001830177.1 | succinate dehydrogenase cytochrome b558 subunit | - |
| F1614_RS03245 | 707880..709664 | - | 1785 | WP_002473256.1 | excinuclease ABC subunit UvrC | - |
| F1614_RS03250 | 709762..710076 | - | 315 | WP_001830148.1 | thioredoxin | - |
| F1614_RS03255 | 710335..712683 | - | 2349 | WP_017464290.1 | endonuclease MutS2 | - |
| F1614_RS03260 | 712693..714402 | - | 1710 | WP_158171750.1 | DNA polymerase/3'-5' exonuclease PolX | - |
| F1614_RS03265 | 714477..714998 | - | 522 | WP_017464288.1 | CvpA family protein | - |
| F1614_RS03270 | 714999..715265 | - | 267 | WP_001830081.1 | cell division protein ZapA | - |
| F1614_RS03275 | 715526..716452 | + | 927 | WP_017464287.1 | ribonuclease HIII | - |
| F1614_RS03280 | 716504..718906 | - | 2403 | WP_017464286.1 | phenylalanine--tRNA ligase subunit beta | - |
| F1614_RS03285 | 718906..719964 | - | 1059 | WP_002494949.1 | phenylalanine--tRNA ligase subunit alpha | - |
| F1614_RS03290 | 720333..721073 | - | 741 | WP_002476601.1 | RNA methyltransferase | - |
| F1614_RS03300 | 721412..723877 | + | 2466 | WP_158171751.1 | YSIRK-type signal peptide-containing protein | - |
| F1614_RS03305 | 724357..724530 | - | 174 | WP_001830121.1 | 50S ribosomal protein L32 | - |
| F1614_RS03310 | 724608..725162 | - | 555 | WP_002473272.1 | DUF177 domain-containing protein | - |
| F1614_RS03315 | 725289..726422 | + | 1134 | WP_059279860.1 | nucleotidyltransferase | - |
| F1614_RS03320 | 726825..727310 | - | 486 | WP_001830072.1 | pantetheine-phosphate adenylyltransferase | - |
| F1614_RS03325 | 727312..727854 | - | 543 | WP_001830140.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| F1614_RS03330 | 727921..728310 | + | 390 | WP_002476596.1 | hypothetical protein | - |
| F1614_RS03335 | 728320..728571 | - | 252 | WP_002439362.1 | DUF2129 domain-containing protein | - |
| F1614_RS03345 | 728792..729718 | + | 927 | WP_017464283.1 | glycerophosphodiester phosphodiesterase | - |
| F1614_RS03350 | 730231..730665 | - | 435 | WP_002498240.1 | YlbF family regulator | - |
| F1614_RS03355 | 730681..731733 | - | 1053 | WP_017464282.1 | CAP domain-containing protein | - |
| F1614_RS03360 | 732174..732635 | - | 462 | WP_001830117.1 | DUF420 domain-containing protein | - |
| F1614_RS03365 | 732661..733572 | - | 912 | WP_059279862.1 | heme o synthase | - |
| F1614_RS03370 | 733874..734782 | + | 909 | WP_002470218.1 | heme A synthase | - |
| F1614_RS03375 | 734925..738374 | - | 3450 | WP_017464279.1 | pyruvate carboxylase | - |
| F1614_RS03380 | 738776..739999 | - | 1224 | WP_017464278.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| F1614_RS03385 | 740401..740676 | - | 276 | WP_001830079.1 | YlaN family protein | - |
| F1614_RS03390 | 740821..741303 | + | 483 | WP_017464277.1 | hypothetical protein | - |
| F1614_RS03395 | 741305..741460 | + | 156 | WP_002446186.1 | DUF2197 domain-containing protein | - |
| F1614_RS03400 | 741479..742538 | - | 1060 | Protein_650 | transposase | - |
| F1614_RS03405 | 742829..744676 | - | 1848 | WP_001831737.1 | translational GTPase TypA | - |
| F1614_RS03410 | 744775..744966 | + | 192 | WP_001831670.1 | DUF5325 family protein | - |
| F1614_RS03415 | 745521..746342 | - | 822 | WP_064206075.1 | inositol monophosphatase family protein | - |
| F1614_RS03420 | 746519..747130 | + | 612 | WP_017464792.1 | DUF1054 domain-containing protein | - |
| F1614_RS03425 | 747260..748606 | + | 1347 | WP_017464793.1 | Nramp family divalent metal transporter | - |
| F1614_RS03430 | 748888..749424 | - | 537 | WP_002476582.1 | DUF4064 domain-containing protein | - |
| F1614_RS03435 | 749730..750881 | - | 1152 | WP_017464794.1 | DUF4064 domain-containing protein | - |
| F1614_RS03440 | 750950..752023 | - | 1074 | WP_017464795.1 | spermidine/putrescine ABC transporter substrate-binding protein | - |
| F1614_RS03445 | 752020..752832 | - | 813 | WP_059279863.1 | ABC transporter permease | - |
| F1614_RS03450 | 752838..753641 | - | 804 | WP_017464797.1 | ABC transporter permease | - |
| F1614_RS03455 | 753634..754728 | - | 1095 | WP_017464798.1 | ABC transporter ATP-binding protein | - |
| F1614_RS03460 | 754740..755279 | - | 540 | WP_002474578.1 | XRE family transcriptional regulator | - |
| F1614_RS03465 | 755418..755696 | - | 279 | WP_002474575.1 | UPF0223 family protein | - |
| F1614_RS03470 | 755987..757393 | - | 1407 | WP_001831650.1 | dihydrolipoyl dehydrogenase | - |
| F1614_RS03475 | 757398..758699 | - | 1302 | WP_001831683.1 | 2-oxo acid dehydrogenase subunit E2 | - |
| F1614_RS03480 | 758830..759807 | - | 978 | WP_002476576.1 | alpha-ketoacid dehydrogenase subunit beta | - |
| F1614_RS03485 | 759811..760923 | - | 1113 | WP_001831653.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| F1614_RS03490 | 761094..761720 | - | 627 | WP_017464800.1 | YkyA family protein | - |
| F1614_RS03495 | 761903..762454 | + | 552 | WP_002457448.1 | peptide deformylase | - |
| F1614_RS03500 | 762886..763104 | + | 219 | WP_001831646.1 | DNA-dependent RNA polymerase auxiliary subunit epsilon family protein | - |
| F1614_RS03505 | 763104..764786 | + | 1683 | WP_158171752.1 | ribonuclease J | - |
| F1614_RS03510 | 765553..766212 | - | 660 | WP_001831652.1 | TrkA family potassium uptake protein | - |
| F1614_RS03515 | 766268..767284 | - | 1017 | WP_017464801.1 | cytochrome d ubiquinol oxidase subunit II | - |
| F1614_RS03520 | 767281..768635 | - | 1355 | Protein_674 | cytochrome ubiquinol oxidase subunit I | - |
| F1614_RS03525 | 768840..769076 | + | 237 | WP_002474548.1 | NrdH-redoxin | - |
| F1614_RS03530 | 769349..771067 | - | 1719 | WP_001831740.1 | phosphoenolpyruvate--protein phosphotransferase | - |
| F1614_RS03535 | 771070..771336 | - | 267 | WP_001831726.1 | phosphocarrier protein HPr | - |
| F1614_RS03540 | 771492..772031 | - | 540 | WP_001831644.1 | hypothetical protein | - |
| F1614_RS03545 | 772091..773263 | - | 1173 | WP_017464803.1 | class I SAM-dependent rRNA methyltransferase | - |
| F1614_RS03550 | 773570..774862 | - | 1293 | WP_002476570.1 | hypothetical protein | - |
| F1614_RS03555 | 775014..775148 | + | 135 | WP_017464804.1 | glycopeptide resistance-associated protein GraF | - |
| F1614_RS03560 | 775564..777339 | - | 1776 | WP_017464805.1 | oleate hydratase | - |
| F1614_RS03565 | 777861..778436 | + | 576 | WP_001831663.1 | ECF transporter S component | - |
| F1614_RS03570 | 778450..779853 | + | 1404 | WP_017464806.1 | energy-coupling factor ABC transporter ATP-binding protein | - |
| F1614_RS03575 | 779846..780652 | + | 807 | WP_002474558.1 | energy-coupling factor transporter transmembrane protein EcfT | - |
| F1614_RS03580 | 780784..782025 | - | 1242 | WP_017464808.1 | phosphoribosylamine--glycine ligase | - |
| F1614_RS03585 | 782051..783529 | - | 1479 | WP_059279866.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| F1614_RS03590 | 783546..784112 | - | 567 | WP_017464809.1 | phosphoribosylglycinamide formyltransferase | - |
| F1614_RS03595 | 784112..785143 | - | 1032 | WP_002476565.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| F1614_RS03600 | 785136..786620 | - | 1485 | WP_002446152.1 | amidophosphoribosyltransferase | - |
| F1614_RS03605 | 786599..788788 | - | 2190 | WP_158171753.1 | phosphoribosylformylglycinamidine synthase subunit PurL | - |
| F1614_RS03610 | 788781..789452 | - | 672 | WP_059279867.1 | phosphoribosylformylglycinamidine synthase I | - |
| F1614_RS03615 | 789454..789714 | - | 261 | WP_001831728.1 | phosphoribosylformylglycinamidine synthase subunit PurS | - |
| F1614_RS03620 | 789714..790418 | - | 705 | WP_002474564.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| F1614_RS03625 | 790419..791546 | - | 1128 | WP_001831674.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| F1614_RS03630 | 791533..792015 | - | 483 | WP_001831735.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| F1614_RS03635 | 792220..793080 | + | 861 | WP_158171754.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| F1614_RS03640 | 793453..793770 | + | 318 | WP_001831741.1 | DUF5011 domain-containing protein | - |
| F1614_RS03645 | 794307..795431 | + | 1125 | WP_001831736.1 | cytochrome aa3 quinol oxidase subunit II | - |
| F1614_RS03650 | 795431..797419 | + | 1989 | WP_001831713.1 | cytochrome aa3 quinol oxidase subunit I | - |
| F1614_RS03655 | 797409..798014 | + | 606 | WP_001831738.1 | cytochrome aa3 quinol oxidase subunit III | - |
| F1614_RS03660 | 798011..798301 | + | 291 | WP_001831700.1 | cytochrome aa3 quinol oxidase subunit IV | - |
| F1614_RS03665 | 798488..799396 | + | 909 | WP_017464812.1 | ribonucleoside hydrolase RihC | - |
| F1614_RS03670 | 799553..800755 | - | 1203 | WP_002474570.1 | serine hydrolase | - |
| F1614_RS03675 | 801562..802800 | + | 1239 | WP_017464813.1 | LCP family protein | - |
| F1614_RS03680 | 802848..803318 | + | 471 | WP_001831729.1 | DUF2538 family protein | - |
| F1614_RS03685 | 803893..804315 | + | 423 | WP_002476560.1 | GNAT family N-acetyltransferase | - |
| F1614_RS03690 | 804556..808563 | + | 4008 | WP_158171755.1 | glucosaminidase domain-containing protein | - |
| F1614_RS03695 | 808803..809222 | - | 420 | WP_002476558.1 | MarR family transcriptional regulator | - |
| F1614_RS03700 | 809376..810383 | + | 1008 | WP_001833065.1 | acyltransferase family protein | - |
| F1614_RS03705 | 810526..811710 | + | 1185 | WP_017465193.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| F1614_RS03710 | 812055..812873 | - | 819 | WP_001831706.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
| F1614_RS03715 | 812866..813669 | - | 804 | WP_002498630.1 | 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase | - |
| F1614_RS03720 | 813656..815329 | - | 1674 | WP_002474057.1 | 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase | - |
| F1614_RS03725 | 815316..816677 | - | 1362 | WP_032605346.1 | isochorismate synthase | - |
| F1614_RS03735 | 816856..817794 | + | 939 | WP_158171756.1 | 1,4-dihydroxy-2-naphthoate polyprenyltransferase | - |
| F1614_RS03740 | 818145..818702 | - | 558 | WP_001831688.1 | GNAT family N-acetyltransferase | - |
| F1614_RS03750 | 818932..819147 | + | 216 | WP_017465195.1 | NINE protein | - |
| F1614_RS03755 | 819625..820356 | + | 732 | WP_158171979.1 | hypothetical protein | - |
| F1614_RS03760 | 820565..821045 | - | 481 | Protein_720 | N-acetylmuramoyl-L-alanine amidase | - |
| F1614_RS03770 | 822420..823883 | - | 1464 | Protein_721 | SH3 domain-containing protein | - |
| F1614_RS03775 | 823858..824268 | - | 411 | WP_017464465.1 | phage holin | - |
| F1614_RS03780 | 824332..824730 | - | 399 | WP_017464464.1 | YxeA family protein | - |
| F1614_RS03785 | 824888..825295 | - | 408 | WP_002499222.1 | hypothetical protein | - |
| F1614_RS03790 | 825282..825707 | - | 426 | WP_158171757.1 | hypothetical protein | - |
| F1614_RS03795 | 825704..826327 | - | 624 | WP_029376548.1 | poly-gamma-glutamate hydrolase family protein | - |
| F1614_RS03800 | 826332..827546 | - | 1215 | WP_017464460.1 | BppU family phage baseplate upper protein | - |
| F1614_RS03805 | 827546..829408 | - | 1863 | WP_158171758.1 | DUF2817 domain-containing protein | - |
| F1614_RS12530 | 829424..829597 | - | 174 | WP_017464458.1 | hypothetical protein | - |
| F1614_RS03810 | 829590..831149 | - | 1560 | WP_199253294.1 | prophage endopeptidase tail family protein | - |
| F1614_RS03815 | 831159..831992 | - | 834 | WP_017464456.1 | phage tail family protein | - |
| F1614_RS03820 | 831994..836490 | - | 4497 | WP_158171760.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| F1614_RS03825 | 836519..836671 | - | 153 | WP_157781582.1 | hypothetical protein | - |
| F1614_RS03830 | 836704..837066 | - | 363 | WP_002499232.1 | hypothetical protein | - |
| F1614_RS03835 | 837130..837315 | - | 186 | WP_002499233.1 | hypothetical protein | - |
| F1614_RS03840 | 837334..837960 | - | 627 | WP_017464454.1 | phage tail protein | - |
| F1614_RS03845 | 837973..838377 | - | 405 | WP_017464453.1 | hypothetical protein | - |
| F1614_RS03850 | 838380..838784 | - | 405 | WP_173636530.1 | hypothetical protein | - |
| F1614_RS03855 | 838781..839110 | - | 330 | WP_002484730.1 | hypothetical protein | - |
| F1614_RS03860 | 839100..839441 | - | 342 | WP_017464452.1 | head-tail connector protein | - |
| F1614_RS03865 | 839460..840797 | - | 1338 | WP_059279869.1 | phage major capsid protein | - |
| F1614_RS03870 | 840839..841396 | - | 558 | WP_017464449.1 | HK97 family phage prohead protease | - |
| F1614_RS03875 | 841383..842618 | - | 1236 | WP_017464448.1 | phage portal protein | - |
| F1614_RS03880 | 842618..842812 | - | 195 | WP_017464447.1 | hypothetical protein | - |
| F1614_RS03885 | 842824..844575 | - | 1752 | Protein_745 | terminase large subunit | - |
| F1614_RS03890 | 844568..845053 | - | 486 | WP_017464445.1 | phage terminase small subunit P27 family | - |
| F1614_RS03895 | 845213..845563 | - | 351 | WP_017464444.1 | HNH endonuclease | - |
| F1614_RS03900 | 846045..846491 | - | 447 | WP_002502054.1 | transcriptional regulator | - |
| F1614_RS03905 | 846852..847154 | + | 303 | WP_017464442.1 | DUF4870 domain-containing protein | - |
| F1614_RS03910 | 847251..847556 | - | 306 | WP_017464441.1 | MazG-like family protein | - |
| F1614_RS03915 | 847624..848334 | + | 711 | WP_017464440.1 | hypothetical protein | - |
| F1614_RS03920 | 848316..848498 | - | 183 | WP_017464439.1 | hypothetical protein | - |
| F1614_RS03925 | 848500..848847 | - | 348 | WP_017464438.1 | hypothetical protein | - |
| F1614_RS03930 | 848870..849757 | - | 888 | WP_158171761.1 | DnaD domain protein | - |
| F1614_RS03935 | 849792..849989 | - | 198 | WP_017464436.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS03940 | 849986..850189 | - | 204 | WP_017464435.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS03945 | 850204..850668 | - | 465 | WP_017464434.1 | single-stranded DNA-binding protein | - |
| F1614_RS03950 | 850669..851286 | - | 618 | WP_158171980.1 | MBL fold metallo-hydrolase | - |
| F1614_RS03955 | 851367..852290 | - | 924 | WP_017464432.1 | recombinase RecT | - |
| F1614_RS03960 | 852292..854241 | - | 1950 | WP_158171762.1 | AAA family ATPase | - |
| F1614_RS03965 | 854244..854507 | - | 264 | WP_002499256.1 | hypothetical protein | - |
| F1614_RS03970 | 854577..854768 | - | 192 | WP_017464430.1 | DUF1270 family protein | - |
| F1614_RS03975 | 854879..855160 | + | 282 | WP_002502040.1 | hypothetical protein | - |
| F1614_RS12535 | 855157..855303 | - | 147 | WP_002502039.1 | hypothetical protein | - |
| F1614_RS03980 | 855319..855528 | - | 210 | WP_158171763.1 | hypothetical protein | - |
| F1614_RS03985 | 855586..855924 | + | 339 | WP_002499261.1 | hypothetical protein | - |
| F1614_RS03990 | 855910..856143 | - | 234 | WP_002499262.1 | DUF2829 domain-containing protein | - |
| F1614_RS03995 | 856159..856914 | - | 756 | WP_049372322.1 | phage regulatory protein/antirepressor Ant | - |
| F1614_RS04000 | 856965..857519 | + | 555 | WP_017464429.1 | hypothetical protein | - |
| F1614_RS12540 | 857526..857663 | - | 138 | WP_017464428.1 | hypothetical protein | - |
| F1614_RS04005 | 857679..857894 | - | 216 | WP_017464427.1 | hypothetical protein | - |
| F1614_RS04010 | 858091..858717 | + | 627 | WP_158171764.1 | XRE family transcriptional regulator | - |
| F1614_RS12545 | 858762..858929 | + | 168 | WP_017464425.1 | hypothetical protein | - |
| F1614_RS04015 | 858933..860090 | + | 1158 | WP_017464424.1 | CapA family protein | - |
| F1614_RS04020 | 860299..860967 | + | 669 | WP_002500136.1 | hypothetical protein | - |
| F1614_RS04025 | 861091..861612 | + | 522 | WP_002500137.1 | hypothetical protein | - |
| F1614_RS04030 | 861605..861976 | + | 372 | WP_002500138.1 | hypothetical protein | - |
| F1614_RS04035 | 862032..863081 | + | 1050 | WP_002500139.1 | site-specific integrase | - |
| F1614_RS04050 | 863482..864057 | - | 576 | WP_017464423.1 | competence protein ComK | - |
| F1614_RS04060 | 864272..864490 | + | 219 | WP_001829292.1 | IDEAL domain-containing protein | - |
| F1614_RS04065 | 864568..865554 | - | 987 | WP_017464421.1 | lipoate--protein ligase | - |
| F1614_RS04070 | 865759..865944 | + | 186 | WP_001829339.1 | DUF2187 family protein | - |
| F1614_RS04075 | 865950..866552 | + | 603 | WP_001829312.1 | hypothetical protein | - |
| F1614_RS04080 | 866655..868160 | - | 1506 | WP_002476551.1 | bifunctional metallophosphatase/5'-nucleotidase | - |
| F1614_RS04085 | 868299..869657 | - | 1359 | WP_002493416.1 | TrkH family potassium uptake protein | - |
| F1614_RS04090 | 869675..871507 | - | 1833 | WP_158171765.1 | S1C family serine protease | - |
| F1614_RS04095 | 871732..872538 | - | 807 | WP_017464419.1 | TerC family protein | - |
| F1614_RS04100 | 872847..874409 | - | 1563 | WP_002446117.1 | peptide chain release factor 3 | - |
| F1614_RS04105 | 874413..874658 | - | 246 | WP_002498620.1 | YueH family protein | - |
| F1614_RS04110 | 874648..876132 | - | 1485 | WP_002498619.1 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase | - |
| F1614_RS04115 | 876653..877828 | + | 1176 | WP_002475762.1 | diglucosyl diacylglycerol synthase | - |
| F1614_RS04120 | 877806..878999 | + | 1194 | WP_059279874.1 | MFS transporter | - |
| F1614_RS04125 | 879265..879774 | - | 510 | WP_002468295.1 | YjcG family protein | - |
| F1614_RS04130 | 879928..880683 | - | 756 | WP_017464418.1 | esterase family protein | - |
| F1614_RS04135 | 880908..881993 | + | 1086 | WP_002457139.1 | AI-2E family transporter | - |
| F1614_RS04140 | 882391..883161 | - | 771 | WP_158171766.1 | enoyl-ACP reductase FabI | - |
| F1614_RS04145 | 883465..883830 | - | 366 | WP_158171767.1 | hypothetical protein | - |
| F1614_RS04150 | 883961..884329 | - | 369 | WP_002498615.1 | DUF3139 domain-containing protein | - |
| F1614_RS04155 | 884472..885164 | + | 693 | WP_029376547.1 | hypothetical protein | - |
| F1614_RS04160 | 885452..885763 | - | 312 | WP_002498613.1 | hypothetical protein | - |
| F1614_RS04165 | 885840..886817 | - | 978 | WP_134811182.1 | hypothetical protein | - |
| F1614_RS04170 | 887011..887433 | + | 423 | WP_017464417.1 | DUF1433 domain-containing protein | - |
| F1614_RS04175 | 887715..888290 | + | 576 | WP_080395195.1 | relaxase/mobilization nuclease domain-containing protein | - |
| F1614_RS12550 | 888363..888654 | + | 292 | Protein_804 | DUF334 domain-containing protein | - |
| F1614_RS04180 | 889126..889584 | - | 459 | WP_158171768.1 | DUF1307 domain-containing protein | - |
| F1614_RS04190 | 890285..890745 | + | 461 | Protein_806 | DUF536 domain-containing protein | - |
| F1614_RS04195 | 890860..891174 | - | 315 | WP_017464414.1 | DUF4176 domain-containing protein | - |
| F1614_RS04200 | 891185..891808 | - | 624 | Protein_808 | DUF443 family protein | - |
| F1614_RS04205 | 892135..892776 | - | 642 | WP_079994838.1 | DUF443 family protein | - |
| F1614_RS04210 | 892932..893645 | - | 714 | WP_017464413.1 | DUF443 family protein | - |
| F1614_RS04215 | 893746..894407 | - | 662 | Protein_811 | DUF443 family protein | - |
| F1614_RS04220 | 895673..896260 | + | 588 | WP_017464411.1 | DUF5080 family protein | - |
| F1614_RS04225 | 896793..897419 | + | 627 | WP_134811181.1 | hypothetical protein | - |
| F1614_RS04230 | 897431..897988 | + | 558 | WP_002474539.1 | DUF1851 domain-containing protein | - |
| F1614_RS04235 | 898099..898789 | + | 691 | Protein_815 | hypothetical protein | - |
| F1614_RS04240 | 899088..899312 | + | 225 | Protein_816 | DUF600 family protein | - |
| F1614_RS04245 | 899601..900235 | - | 635 | Protein_817 | DUF443 family protein | - |
| F1614_RS12555 | 900242..900400 | - | 159 | WP_017464408.1 | hypothetical protein | - |
| F1614_RS04250 | 900945..902789 | - | 1845 | WP_017464407.1 | monovalent cation:proton antiporter family protein | - |
| F1614_RS04255 | 902799..904184 | - | 1386 | WP_017464406.1 | magnesium transporter | - |
| F1614_RS04260 | 904209..905063 | - | 855 | WP_059279875.1 | RluA family pseudouridine synthase | - |
| F1614_RS04265 | 905060..905869 | - | 810 | WP_001829306.1 | NAD kinase | - |
| F1614_RS04270 | 905883..906518 | - | 636 | WP_001829266.1 | GTP pyrophosphokinase family protein | - |
| F1614_RS04275 | 906535..906882 | - | 348 | WP_001829330.1 | hypothetical protein | - |
| F1614_RS04280 | 907166..907756 | + | 591 | WP_002474525.1 | CYTH domain-containing protein | - |
| F1614_RS04285 | 907838..908203 | + | 366 | WP_002467876.1 | truncated hemoglobin YjbI | - |
| F1614_RS04290 | 908226..909023 | + | 798 | WP_001829256.1 | protease adaptor protein YjbH | - |
| F1614_RS04295 | 909488..911296 | - | 1809 | WP_001829279.1 | oligoendopeptidase F | - |
| F1614_RS04300 | 911347..912327 | - | 981 | Protein_829 | competence protein | - |
| F1614_RS04305 | 912423..913145 | - | 723 | WP_002495410.1 | adaptor protein MecA | - |
| F1614_RS04310 | 913497..913892 | - | 396 | WP_001829294.1 | transcriptional regulator Spx | - |
| F1614_RS04315 | 914183..915172 | + | 990 | WP_002474543.1 | tryptophan--tRNA ligase | - |
| F1614_RS04320 | 915201..916082 | - | 882 | WP_059279876.1 | ABC transporter permease | - |
| F1614_RS04325 | 916099..917061 | - | 963 | WP_017464403.1 | ABC transporter permease | - |
| F1614_RS04330 | 917054..918037 | - | 984 | WP_017464402.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS04335 | 918030..919025 | - | 996 | WP_158171769.1 | ABC transporter ATP-binding protein | - |
| F1614_RS04340 | 919077..920789 | - | 1713 | WP_017464401.1 | ABC transporter substrate-binding protein | - |
| F1614_RS04345 | 920977..921186 | + | 210 | Protein_838 | DUF3899 domain-containing protein | - |
| F1614_RS04350 | 921257..922501 | - | 1245 | WP_017464399.1 | beta-ketoacyl-ACP synthase II | - |
| F1614_RS04355 | 922513..923453 | - | 941 | Protein_840 | ketoacyl-ACP synthase III | - |
| F1614_RS04360 | 923734..923928 | + | 195 | WP_002457178.1 | YjzD family protein | - |
| F1614_RS04365 | 924107..926716 | - | 2610 | WP_017464397.1 | ATP-dependent chaperone ClpB | - |
| F1614_RS04370 | 926925..928748 | - | 1824 | WP_017464396.1 | acetyltransferase | - |
| F1614_RS04375 | 929143..929451 | - | 309 | WP_001829290.1 | metal-sulfur cluster assembly factor | - |
| F1614_RS04380 | 929564..930385 | + | 822 | WP_002456959.1 | Cof-type HAD-IIB family hydrolase | - |
| F1614_RS04385 | 930463..931779 | + | 1317 | WP_002498261.1 | CoA-disulfide reductase | - |
| F1614_RS04390 | 931975..932376 | - | 402 | WP_001831989.1 | YisL family protein | - |
| F1614_RS04395 | 932732..933637 | - | 906 | WP_001831933.1 | fumarylacetoacetate hydrolase family protein | - |
| F1614_RS04400 | 933836..937492 | - | 3657 | WP_017464393.1 | helicase-exonuclease AddAB subunit AddA | - |
| F1614_RS04405 | 937479..940958 | - | 3480 | WP_158171770.1 | helicase-exonuclease AddAB subunit AddB | - |
| F1614_RS04410 | 941078..941653 | - | 576 | WP_002456954.1 | signal peptidase I | - |
| F1614_RS04415 | 941672..942193 | - | 522 | WP_002474545.1 | signal peptidase I | - |
| F1614_RS04420 | 942197..942772 | - | 576 | WP_158171771.1 | TVP38/TMEM64 family protein | - |
| F1614_RS04425 | 943104..944435 | - | 1332 | WP_017464390.1 | glucose-6-phosphate isomerase | - |
| F1614_RS04430 | 944782..945987 | + | 1206 | WP_001832499.1 | argininosuccinate synthase | - |
| F1614_RS04435 | 945977..947368 | + | 1392 | WP_002476513.1 | argininosuccinate lyase | - |
| F1614_RS04440 | 947519..948568 | + | 1050 | WP_158171772.1 | glycerophosphodiester phosphodiesterase | - |
| F1614_RS04445 | 948760..950004 | - | 1245 | WP_158171773.1 | Glu/Leu/Phe/Val dehydrogenase | - |
| F1614_RS04450 | 950113..951303 | - | 1191 | WP_002498266.1 | ornithine--oxo-acid transaminase | - |
| F1614_RS04455 | 951525..952050 | - | 526 | Protein_860 | transposase | - |
| F1614_RS04460 | 952463..953590 | - | 1128 | WP_017464946.1 | NADH-dependent flavin oxidoreductase | - |
| F1614_RS04465 | 953911..954291 | - | 381 | WP_001831918.1 | S1 RNA-binding domain-containing protein | - |
| F1614_RS04470 | 954754..955347 | - | 594 | WP_017464945.1 | peptidylprolyl isomerase | - |
| F1614_RS04475 | 955413..955793 | + | 381 | WP_017464944.1 | kinase-associated lipoprotein B | - |
| F1614_RS04480 | 955987..958392 | + | 2406 | WP_017464943.1 | Na+/H+ antiporter subunit A | - |
| F1614_RS04485 | 958385..958813 | + | 429 | WP_002446042.1 | Na+/H+ antiporter Mnh1 subunit B | - |
| F1614_RS04490 | 958813..959160 | + | 348 | WP_001831949.1 | Na+/H+ antiporter Mnh1 subunit C | - |
| F1614_RS04495 | 959147..960643 | + | 1497 | WP_002474223.1 | Na+/H+ antiporter Mnh1 subunit D | - |
| F1614_RS04500 | 960645..961124 | + | 480 | WP_002474318.1 | Na+/H+ antiporter subunit E | - |
| F1614_RS04505 | 961124..961417 | + | 294 | WP_001831940.1 | Na+/H+ antiporter Mnh1 subunit F | - |
| F1614_RS04510 | 961395..961751 | + | 357 | WP_001831900.1 | Na+/H+ antiporter Mnh1 subunit G | - |
| F1614_RS04515 | 962053..963207 | + | 1155 | WP_017464942.1 | SidA/IucD/PvdA family monooxygenase | - |
| F1614_RS04520 | 963266..963640 | - | 375 | WP_002493452.1 | PaaI family thioesterase | - |
| F1614_RS04525 | 963663..964979 | - | 1317 | WP_158171774.1 | Na+/H+ antiporter family protein | - |
| F1614_RS04530 | 965165..966646 | - | 1482 | WP_017464941.1 | leucyl aminopeptidase family protein | - |
| F1614_RS04535 | 966966..968174 | - | 1209 | WP_001831966.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| F1614_RS04540 | 968445..968804 | - | 360 | WP_002476502.1 | iron-sulfur cluster assembly accessory protein | - |
| F1614_RS04545 | 968833..969078 | - | 246 | WP_002474224.1 | YuzB family protein | - |
| F1614_RS04550 | 969360..970424 | + | 1065 | WP_002474218.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| F1614_RS04555 | 970617..970937 | - | 321 | WP_002474296.1 | YuzD family protein | - |
| F1614_RS04560 | 971037..971279 | + | 243 | WP_001831958.1 | NifU family protein | - |
| F1614_RS04565 | 971577..972815 | - | 1239 | WP_059279882.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| F1614_RS04570 | 972812..973048 | - | 237 | WP_017464938.1 | D-alanine--poly(phosphoribitol) ligase subunit 2 | - |
| F1614_RS04575 | 973066..974280 | - | 1215 | WP_017464937.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| F1614_RS04580 | 974277..975734 | - | 1458 | WP_002493459.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| F1614_RS04585 | 975750..975896 | - | 147 | WP_001831913.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| F1614_RS04590 | 976302..977273 | - | 972 | WP_002493460.1 | D-glycerate dehydrogenase | - |
| F1614_RS04595 | 977314..978093 | - | 780 | WP_001831998.1 | TIGR01457 family HAD-type hydrolase | - |
| F1614_RS04600 | 978093..978527 | - | 435 | WP_001831932.1 | DUF86 domain-containing protein | - |
| F1614_RS04605 | 978646..978912 | + | 267 | WP_002439025.1 | DUF3055 domain-containing protein | - |
| F1614_RS04610 | 978972..979361 | - | 390 | WP_001831895.1 | DUF1027 domain-containing protein | - |
| F1614_RS04615 | 979549..980463 | - | 915 | WP_001831979.1 | lipoyl synthase | - |
| F1614_RS04620 | 980552..981871 | - | 1320 | WP_017464936.1 | bifunctional metallophosphatase/5'-nucleotidase | - |
| F1614_RS04625 | 981957..982784 | - | 828 | WP_002474266.1 | sulfite exporter TauE/SafE family protein | - |
| F1614_RS04630 | 982797..983645 | - | 849 | WP_002493462.1 | DUF72 domain-containing protein | - |
| F1614_RS04635 | 984012..985037 | - | 1026 | WP_002476489.1 | DUF21 domain-containing protein | - |
| F1614_RS04640 | 985583..985993 | - | 411 | WP_017464935.1 | DUF4064 domain-containing protein | - |
| F1614_RS04645 | 986007..986370 | - | 364 | Protein_898 | DUF4467 domain-containing protein | - |
| F1614_RS04650 | 986461..986667 | - | 207 | WP_002474287.1 | hypothetical protein | - |
| F1614_RS04655 | 986999..987274 | - | 276 | WP_029376577.1 | hypothetical protein | - |
| F1614_RS04665 | 987826..989223 | - | 1398 | WP_001831980.1 | Fe-S cluster assembly protein SufB | - |
| F1614_RS04670 | 989418..989882 | - | 465 | WP_017464930.1 | SUF system NifU family Fe-S cluster assembly protein | - |
| F1614_RS04675 | 989872..991113 | - | 1242 | WP_017464929.1 | cysteine desulfurase | - |
| F1614_RS04680 | 991181..992488 | - | 1308 | WP_001831898.1 | Fe-S cluster assembly protein SufD | - |
| F1614_RS04685 | 992583..993344 | - | 762 | WP_001831944.1 | Fe-S cluster assembly ATPase SufC | - |
| F1614_RS04690 | 993666..994526 | + | 861 | WP_017464927.1 | DUF368 domain-containing protein | - |
| F1614_RS04695 | 994592..994783 | - | 192 | WP_001831967.1 | CsbD family protein | - |
| F1614_RS04700 | 994957..995115 | + | 159 | WP_001831893.1 | hypothetical protein | - |
| F1614_RS04705 | 995384..996196 | - | 813 | WP_002468872.1 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
| F1614_RS04710 | 996217..996912 | - | 696 | WP_002498330.1 | ABC transporter permease | - |
| F1614_RS04715 | 996905..997930 | - | 1026 | WP_001831992.1 | methionine ABC transporter ATP-binding protein | - |
| F1614_RS04720 | 998184..998480 | - | 297 | WP_002474231.1 | thioredoxin family protein | - |
| F1614_RS04725 | 998473..998859 | - | 387 | WP_002474275.1 | toprim domain-containing protein | - |
| F1614_RS04735 | 999434..999814 | - | 381 | WP_002498428.1 | glycine cleavage system protein GcvH | - |
| F1614_RS04740 | 999988..1000341 | - | 354 | WP_002474252.1 | arsenate reductase family protein | - |
| F1614_RS04745 | 1000485..1000808 | + | 324 | WP_002476478.1 | thioredoxin family protein | - |
| F1614_RS04750 | 1000984..1001526 | - | 543 | WP_001831981.1 | nitroreductase | - |
| F1614_RS04755 | 1001607..1002323 | - | 717 | WP_017464635.1 | type I 3-dehydroquinate dehydratase | - |
| F1614_RS04760 | 1002484..1002906 | + | 423 | WP_002457221.1 | organic hydroperoxide resistance protein | - |
| F1614_RS04770 | 1003312..1003812 | + | 501 | WP_002474267.1 | GNAT family N-acetyltransferase | - |
| F1614_RS04775 | 1004083..1004670 | - | 588 | WP_017464633.1 | histidine phosphatase family protein | - |
| F1614_RS04780 | 1004883..1005119 | + | 237 | WP_002457224.1 | hypothetical protein | - |
| F1614_RS04785 | 1005111..1005314 | - | 204 | WP_017464632.1 | sterile alpha motif-like domain-containing protein | - |
| F1614_RS04790 | 1006002..1006190 | + | 189 | WP_001829569.1 | hypothetical protein | - |
| F1614_RS04795 | 1006380..1006934 | + | 555 | WP_002493471.1 | hypothetical protein | - |
| F1614_RS04800 | 1006994..1007227 | - | 234 | WP_001829664.1 | hypothetical protein | - |
| F1614_RS04805 | 1007512..1008258 | + | 747 | WP_017464631.1 | poly-gamma-glutamate hydrolase family protein | - |
| F1614_RS04810 | 1008356..1008640 | + | 285 | WP_002474308.1 | hypothetical protein | - |
| F1614_RS04815 | 1008665..1008889 | + | 225 | WP_017464630.1 | hypothetical protein | - |
| F1614_RS04820 | 1009511..1009711 | - | 201 | WP_002493475.1 | cold-shock protein | - |
| F1614_RS04825 | 1010607..1010681 | + | 75 | WP_095658922.1 | epsilon family phenol-soluble modulin | - |
| F1614_RS04830 | 1011079..1012020 | - | 942 | WP_158171775.1 | cation diffusion facilitator family transporter | - |
| F1614_RS04835 | 1012310..1012813 | + | 504 | WP_017464628.1 | DUF1440 domain-containing protein | - |
| F1614_RS12560 | 1013324..1013500 | + | 177 | WP_199253295.1 | hypothetical protein | - |
| F1614_RS04845 | 1014310..1014726 | + | 417 | WP_017464626.1 | glyoxalase | - |
| F1614_RS04850 | 1014946..1015290 | - | 345 | WP_002503597.1 | DUF4260 domain-containing protein | - |
| F1614_RS04860 | 1015516..1016823 | + | 1308 | WP_158171776.1 | TrkH family potassium uptake protein | - |
| F1614_RS04865 | 1017436..1017669 | + | 234 | WP_002476468.1 | hypothetical protein | - |
| F1614_RS04870 | 1018004..1018405 | - | 402 | WP_017464625.1 | DUF1433 domain-containing protein | - |
| F1614_RS04875 | 1018395..1018793 | - | 399 | WP_002474271.1 | DUF1433 domain-containing protein | - |
| F1614_RS04880 | 1018783..1019187 | - | 405 | WP_017464624.1 | DUF1433 domain-containing protein | - |
| F1614_RS04885 | 1019365..1019598 | + | 234 | WP_002474248.1 | hypothetical protein | - |
| F1614_RS04890 | 1020470..1020769 | - | 300 | WP_002476463.1 | hypothetical protein | - |
| F1614_RS04895 | 1020781..1022295 | - | 1515 | WP_158171777.1 | hypothetical protein | - |
| F1614_RS04900 | 1022334..1022759 | + | 426 | WP_177180847.1 | DUF1433 domain-containing protein | - |
| F1614_RS04905 | 1022832..1023329 | - | 498 | WP_158171778.1 | terminase small subunit | - |
| F1614_RS04910 | 1023341..1023622 | - | 282 | Protein_947 | CHAP domain-containing protein | - |
| F1614_RS04915 | 1023854..1024234 | - | 381 | WP_158171981.1 | DUF1433 domain-containing protein | - |
| F1614_RS04925 | 1025448..1025918 | - | 471 | WP_001829588.1 | SsrA-binding protein SmpB | - |
| F1614_RS04930 | 1025943..1028321 | - | 2379 | WP_158171779.1 | ribonuclease R | - |
| F1614_RS04935 | 1028356..1029096 | - | 741 | WP_001829672.1 | carboxylesterase | - |
| F1614_RS04940 | 1029397..1029630 | - | 234 | WP_001829669.1 | preprotein translocase subunit SecG | - |
| F1614_RS04945 | 1029699..1030157 | - | 459 | WP_001829646.1 | hypothetical protein | - |
| F1614_RS04950 | 1030323..1031627 | - | 1305 | WP_001829595.1 | phosphopyruvate hydratase | - |
| F1614_RS04955 | 1031766..1033283 | - | 1518 | WP_002473969.1 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - |
| F1614_RS04960 | 1033286..1034047 | - | 762 | WP_017464621.1 | triose-phosphate isomerase | - |
| F1614_RS04965 | 1034178..1035368 | - | 1191 | WP_002457578.1 | phosphoglycerate kinase | - |
| F1614_RS04970 | 1035562..1036572 | - | 1011 | WP_001829667.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| F1614_RS04975 | 1036624..1037637 | - | 1014 | WP_002473973.1 | sugar-binding transcriptional regulator | - |
| F1614_RS04980 | 1037993..1038229 | + | 237 | WP_017464620.1 | hypothetical protein | - |
| F1614_RS04985 | 1038402..1039022 | - | 621 | WP_199253296.1 | DUF4887 domain-containing protein | - |
| F1614_RS04990 | 1039889..1040788 | + | 900 | WP_001829630.1 | TIGR01777 family oxidoreductase | - |
| F1614_RS04995 | 1040819..1041010 | + | 192 | WP_017464618.1 | hypothetical protein | - |
| F1614_RS05000 | 1041272..1041856 | - | 585 | WP_001829659.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
| F1614_RS05010 | 1042184..1043128 | - | 945 | WP_002445957.1 | DNA-binding protein WhiA | - |
| F1614_RS05015 | 1043257..1044252 | - | 996 | WP_001829626.1 | uridine diphosphate-N-acetylglucosamine-binding protein YvcK | - |
| F1614_RS05020 | 1044252..1045160 | - | 909 | WP_002473939.1 | RNase adapter RapZ | - |
| F1614_RS05025 | 1045336..1046268 | - | 933 | WP_002438914.1 | thioredoxin-disulfide reductase | - |
| F1614_RS05030 | 1046333..1047772 | - | 1440 | WP_002476440.1 | tetratricopeptide repeat protein | - |
| F1614_RS05035 | 1047739..1048275 | - | 537 | WP_080035309.1 | acyltransferase | - |
| F1614_RS05040 | 1048272..1049111 | - | 840 | WP_001829638.1 | prolipoprotein diacylglyceryl transferase | - |
| F1614_RS05045 | 1049117..1050049 | - | 933 | WP_002473946.1 | HPr kinase/phosphorylase | - |
| F1614_RS05050 | 1050402..1053239 | - | 2838 | WP_002473960.1 | excinuclease ABC subunit UvrA | - |
| F1614_RS05055 | 1053247..1055232 | - | 1986 | WP_002438912.1 | excinuclease ABC subunit UvrB | - |
| F1614_RS05065 | 1055789..1056022 | - | 234 | WP_001832593.1 | CsbA family protein | - |
| F1614_RS05070 | 1056028..1056669 | - | 642 | WP_002473961.1 | HD domain-containing protein | - |
| F1614_RS05075 | 1056978..1057778 | - | 801 | WP_017464614.1 | CHAP domain-containing protein | - |
| F1614_RS05085 | 1059430..1061964 | - | 2535 | WP_001829572.1 | preprotein translocase subunit SecA | - |
| F1614_RS05090 | 1062630..1063199 | - | 570 | WP_001829676.1 | ribosome-associated translation inhibitor RaiA | - |
| F1614_RS05095 | 1063260..1063934 | - | 675 | WP_002473968.1 | ComF family protein | - |
| F1614_RS05100 | 1063927..1065195 | - | 1269 | WP_186297870.1 | DEAD/DEAH box helicase family protein | - |
| F1614_RS05105 | 1065333..1066199 | - | 867 | WP_002473942.1 | fatty acid kinase binding subunit FakB1 | - |
| F1614_RS05110 | 1066344..1066985 | + | 642 | WP_158171782.1 | YigZ family protein | - |
| F1614_RS05115 | 1067046..1068125 | - | 1080 | WP_001829686.1 | undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase | - |
| F1614_RS05120 | 1068471..1069541 | + | 1071 | WP_029376555.1 | GGDEF domain-containing protein | - |
| F1614_RS05125 | 1069736..1070497 | + | 762 | WP_001829644.1 | threonine/serine exporter ThrE family protein | - |
| F1614_RS05130 | 1070513..1071007 | + | 495 | WP_001829634.1 | threonine/serine exporter family protein | - |
| F1614_RS05135 | 1071028..1072266 | + | 1239 | WP_158171783.1 | peptidase T | - |
| F1614_RS05140 | 1072357..1073487 | - | 1131 | WP_017464610.1 | glycerate kinase | - |
| F1614_RS05145 | 1073758..1074078 | - | 321 | WP_001829675.1 | bacillithiol system redox-active protein YtxJ | - |
| F1614_RS05150 | 1074227..1075117 | - | 891 | WP_002493499.1 | EMYY motif lipoprotein | - |
| F1614_RS05155 | 1075234..1075761 | + | 528 | WP_002473944.1 | GrpB family protein | - |
| F1614_RS05160 | 1075878..1076810 | + | 933 | WP_017464609.1 | UDP-N-acetylmuramate dehydrogenase | - |
| F1614_RS05165 | 1076832..1077146 | + | 315 | WP_002473966.1 | hypothetical protein | - |
| F1614_RS05170 | 1077298..1078341 | - | 1044 | WP_158171784.1 | ABC transporter substrate-binding protein | - |
| F1614_RS05175 | 1078421..1079200 | - | 780 | WP_002493501.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS05180 | 1079197..1080156 | - | 960 | WP_017464607.1 | iron chelate uptake ABC transporter family permease subunit | - |
| F1614_RS05185 | 1080140..1081114 | - | 975 | WP_017464606.1 | ABC transporter permease | - |
| F1614_RS05190 | 1081130..1081388 | - | 259 | Protein_1000 | hypothetical protein | - |
| F1614_RS05195 | 1081363..1082331 | - | 969 | WP_001829597.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| F1614_RS05200 | 1082450..1084555 | - | 2106 | WP_158171785.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| F1614_RS05205 | 1084518..1084916 | - | 399 | WP_002473976.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| F1614_RS05210 | 1085673..1086548 | + | 876 | WP_002473943.1 | DMT family transporter | - |
| F1614_RS05215 | 1086562..1087062 | + | 501 | WP_001832596.1 | preQ(1) synthase | - |
| F1614_RS05220 | 1087346..1088851 | + | 1506 | WP_002473947.1 | peptide MFS transporter | - |
| F1614_RS05225 | 1089134..1089298 | + | 165 | Protein_1007 | IS5/IS1182 family transposase | - |
| F1614_RS05230 | 1089506..1090429 | + | 924 | WP_017464604.1 | diacylglycerol kinase family lipid kinase | - |
| F1614_RS05235 | 1090828..1093437 | + | 2610 | WP_059279890.1 | bifunctional acetaldehyde-CoA/alcohol dehydrogenase | - |
| F1614_RS05240 | 1093505..1094044 | - | 540 | WP_002473198.1 | 5'-3'-deoxyribonucleotidase | - |
| F1614_RS05245 | 1094167..1095222 | - | 1056 | WP_002493508.1 | histidinol-phosphate transaminase | - |
| F1614_RS05250 | 1095425..1096938 | - | 1514 | Protein_1012 | ABC transporter permease/substrate-binding protein | - |
| F1614_RS05255 | 1096931..1097905 | - | 975 | WP_017464601.1 | ABC transporter ATP-binding protein | - |
| F1614_RS05260 | 1098105..1099886 | - | 1782 | WP_134811187.1 | DNA helicase RecQ | - |
| F1614_RS05265 | 1099897..1101786 | - | 1890 | WP_199253301.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| F1614_RS05270 | 1101908..1102723 | + | 816 | Protein_1016 | ZIP family metal transporter | - |
| F1614_RS05275 | 1103000..1103182 | - | 183 | Protein_1017 | hypothetical protein | - |
| F1614_RS05280 | 1103612..1105552 | - | 1941 | WP_017465269.1 | polyglycerol-phosphate lipoteichoic acid synthase LtaS | - |
| F1614_RS05285 | 1106104..1107108 | - | 1005 | WP_158171787.1 | biotin-dependent carboxyltransferase family protein | - |
| F1614_RS05290 | 1107096..1107827 | - | 732 | WP_001830356.1 | allophanate hydrolase subunit 1 | - |
| F1614_RS05295 | 1107846..1108052 | - | 207 | WP_001830353.1 | hypothetical protein | - |
| F1614_RS05300 | 1108101..1108709 | - | 609 | WP_017465272.1 | aminotransferase class IV | - |
| F1614_RS05305 | 1108711..1109862 | - | 1152 | WP_017465273.1 | anthranilate synthase component I family protein | - |
| F1614_RS05310 | 1109852..1110439 | - | 588 | WP_017465274.1 | aminodeoxychorismate/anthranilate synthase component II | - |
| F1614_RS05315 | 1110736..1111407 | + | 672 | WP_002445903.1 | 7-cyano-7-deazaguanine synthase QueC | - |
| F1614_RS05320 | 1111412..1111831 | + | 420 | WP_001830341.1 | 6-carboxytetrahydropterin synthase QueD | - |
| F1614_RS05325 | 1111832..1112545 | + | 714 | WP_002476405.1 | 7-carboxy-7-deazaguanine synthase QueE | - |
| F1614_RS05330 | 1112647..1113246 | + | 600 | WP_017465275.1 | hypothetical protein | - |
| F1614_RS05335 | 1114135..1114572 | + | 438 | WP_001830329.1 | DM13 domain-containing protein | - |
| F1614_RS05340 | 1114623..1115096 | + | 474 | WP_001830332.1 | DoxX family protein | - |
| F1614_RS05345 | 1115071..1115760 | + | 690 | WP_001830352.1 | response regulator transcription factor SaeR | - |
| F1614_RS05350 | 1115763..1116815 | + | 1053 | WP_029376549.1 | HAMP domain-containing histidine kinase | - |
| F1614_RS05355 | 1116885..1117991 | - | 1107 | WP_059279892.1 | glycosyltransferase family 2 protein | - |
| F1614_RS05365 | 1118194..1119033 | - | 840 | WP_001830355.1 | aldo/keto reductase | - |
| F1614_RS05370 | 1119275..1120624 | - | 1350 | WP_002476401.1 | hemolysin family protein | - |
| F1614_RS05375 | 1120861..1122033 | - | 1173 | WP_002474370.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| F1614_RS05380 | 1122407..1124359 | - | 1953 | WP_158171788.1 | fructose-specific PTS transporter subunit EIIC | - |
| F1614_RS05385 | 1124365..1125285 | - | 921 | WP_001830344.1 | 1-phosphofructokinase | - |
| F1614_RS05390 | 1125282..1126040 | - | 759 | WP_002476398.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| F1614_RS05400 | 1126296..1126778 | - | 483 | WP_158171789.1 | Cys-tRNA(Pro) deacylase | - |
| F1614_RS05405 | 1126892..1127362 | - | 471 | WP_158171790.1 | hypothetical protein | - |
| F1614_RS05410 | 1127743..1128906 | - | 1164 | WP_002474388.1 | multidrug efflux MFS transporter NorA | - |
| F1614_RS05415 | 1129317..1129934 | + | 618 | WP_199253297.1 | DUF1361 domain-containing protein | - |
| F1614_RS05420 | 1129931..1130200 | + | 270 | WP_064206183.1 | hypothetical protein | - |
| F1614_RS05425 | 1130250..1131623 | - | 1374 | WP_017464499.1 | DNA photolyase family protein | - |
| F1614_RS05430 | 1131818..1133374 | - | 1557 | WP_059279896.1 | DASS family sodium-coupled anion symporter | - |
| F1614_RS05435 | 1133507..1134448 | - | 942 | WP_017464497.1 | malate dehydrogenase | - |
| F1614_RS05440 | 1134577..1134870 | - | 294 | WP_001830319.1 | hypothetical protein | - |
| F1614_RS05445 | 1134892..1135818 | - | 927 | WP_002493526.1 | GTP-binding protein | - |
| F1614_RS05455 | 1136039..1136482 | + | 444 | WP_001830335.1 | HTH-type transcriptional regulator MgrA | - |
| F1614_RS05460 | 1136725..1138419 | - | 1695 | WP_017464496.1 | thiol reductant ABC exporter subunit CydC | - |
| F1614_RS05465 | 1138416..1140050 | - | 1635 | WP_199253298.1 | ABC transporter ATP-binding protein/permease | - |
| F1614_RS05470 | 1140261..1141133 | + | 873 | WP_001832082.1 | undecaprenyl-diphosphate phosphatase | - |
| F1614_RS05475 | 1141415..1141879 | - | 465 | WP_017464494.1 | GyrI-like domain-containing protein | - |
| F1614_RS05480 | 1142076..1142756 | + | 681 | WP_001832119.1 | hypothetical protein | - |
| F1614_RS05485 | 1142759..1143208 | + | 450 | WP_158171793.1 | YaiI/YqxD family protein | - |
| F1614_RS05490 | 1143219..1143785 | + | 567 | WP_002469191.1 | TIGR00730 family Rossman fold protein | - |
| F1614_RS05495 | 1144084..1144632 | - | 549 | WP_002468450.1 | GNAT family N-acetyltransferase | - |
| F1614_RS05500 | 1144758..1145054 | - | 297 | WP_001832178.1 | hypothetical protein | - |
| F1614_RS05505 | 1145188..1145607 | - | 420 | WP_002493267.1 | hypothetical protein | - |
| F1614_RS05510 | 1146035..1146724 | + | 690 | WP_017464492.1 | DUF1129 family protein | - |
| F1614_RS05515 | 1146780..1147268 | - | 489 | WP_002474395.1 | DUF456 domain-containing protein | - |
| F1614_RS05520 | 1147275..1148483 | - | 1209 | WP_059279897.1 | sugar efflux transporter | - |
| F1614_RS05525 | 1148541..1149395 | - | 855 | WP_001832044.1 | LysR family transcriptional regulator | - |
| F1614_RS05530 | 1149476..1150069 | - | 594 | WP_002474401.1 | DUF402 domain-containing protein | - |
| F1614_RS05535 | 1150358..1150543 | - | 186 | WP_002474382.1 | hypothetical protein | - |
| F1614_RS05540 | 1150563..1151708 | - | 1146 | WP_002474367.1 | nitric oxide dioxygenase | - |
| F1614_RS05545 | 1151880..1152554 | + | 675 | WP_158171794.1 | iron-sulfur cluster repair di-iron protein ScdA | - |
| F1614_RS05550 | 1152807..1153283 | - | 477 | WP_158171795.1 | cupin domain-containing protein | - |
| F1614_RS05555 | 1153283..1153999 | - | 717 | WP_017464489.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| F1614_RS05560 | 1154251..1154610 | - | 360 | WP_017464488.1 | MarR family transcriptional regulator | - |
| F1614_RS05565 | 1154725..1156899 | - | 2175 | WP_158171796.1 | AraC family transcriptional regulator | - |
| F1614_RS05570 | 1157164..1157823 | - | 660 | WP_002493261.1 | Bax inhibitor-1 family protein | - |
| F1614_RS05575 | 1158234..1159034 | + | 801 | WP_002469187.1 | LysM peptidoglycan-binding domain-containing protein | - |
| F1614_RS05580 | 1159228..1160238 | - | 1011 | WP_002457533.1 | inorganic phosphate transporter family protein | - |
| F1614_RS05585 | 1160253..1160870 | - | 618 | WP_002457534.1 | DUF47 domain-containing protein | - |
| F1614_RS05590 | 1161392..1163281 | - | 1890 | WP_002493260.1 | ABC transporter permease VraG | - |
| F1614_RS05595 | 1163271..1164032 | - | 762 | WP_002493259.1 | ABC transporter ATP-binding protein VraF | - |
| F1614_RS05600 | 1164178..1165218 | - | 1041 | WP_002493258.1 | histidine kinase GraS/ApsS | - |
| F1614_RS05605 | 1165211..1165885 | - | 675 | WP_001832046.1 | response regulator transcription factor GraR/ApsR | - |
| F1614_RS05610 | 1165904..1166827 | - | 924 | WP_017464485.1 | auxiliary protein GraX/ApsX | - |
| F1614_RS05615 | 1166936..1167442 | + | 507 | WP_017464484.1 | GNAT family N-acetyltransferase | - |
| F1614_RS05620 | 1168003..1169052 | - | 1050 | WP_002493256.1 | alpha/beta hydrolase | - |
| F1614_RS05625 | 1169331..1170398 | - | 1068 | WP_158171797.1 | hypothetical protein | - |
| F1614_RS05630 | 1170622..1171122 | - | 501 | WP_001832127.1 | hypothetical protein | - |
| F1614_RS05635 | 1171472..1172269 | - | 798 | WP_002493540.1 | ABC transporter ATP-binding protein | - |
| F1614_RS05640 | 1172628..1173461 | - | 834 | WP_002474400.1 | YitT family protein | - |
| F1614_RS05650 | 1173998..1175227 | - | 1230 | WP_002493541.1 | nucleoside permease | - |
| F1614_RS05655 | 1175513..1177240 | - | 1728 | WP_002476367.1 | ABC transporter ATP-binding protein/permease | - |
| F1614_RS05670 | 1178225..1178623 | - | 399 | WP_001833002.1 | glycerol-3-phosphate cytidylyltransferase | - |
| F1614_RS05675 | 1178758..1179822 | - | 1065 | WP_002476366.1 | glycosyltransferase | - |
| F1614_RS05680 | 1179822..1180913 | - | 1092 | WP_017464483.1 | CDP-glycerol glycerophosphotransferase family protein | - |
| F1614_RS05685 | 1181236..1182048 | - | 813 | WP_002445834.1 | ABC transporter permease | - |
| F1614_RS05690 | 1182380..1183174 | + | 795 | WP_002474394.1 | teichoic acids export ABC transporter ATP-binding subunit TagH | - |
| F1614_RS05695 | 1183252..1184010 | - | 759 | WP_002476364.1 | WecB/TagA/CpsF family glycosyltransferase | - |
| F1614_RS05700 | 1184185..1184931 | + | 747 | WP_002474350.1 | M50 family metallopeptidase | - |
| F1614_RS05705 | 1185096..1185740 | - | 645 | WP_002493545.1 | metal-dependent transcriptional regulator | - |
| F1614_RS05710 | 1185860..1186606 | + | 747 | WP_158171798.1 | metal ABC transporter ATP-binding protein | - |
| F1614_RS05715 | 1186607..1187443 | + | 837 | WP_001832042.1 | metal ABC transporter permease | - |
| F1614_RS05720 | 1187440..1188369 | + | 930 | WP_002474380.1 | zinc ABC transporter substrate-binding protein | - |
| F1614_RS05725 | 1189103..1191142 | - | 2040 | WP_059279899.1 | sodium:proton antiporter | - |
| F1614_RS05730 | 1191589..1192053 | - | 465 | WP_002474396.1 | Na+/H+ antiporter Mnh2 subunit G | - |
| F1614_RS05735 | 1192028..1192330 | - | 303 | WP_001832031.1 | Na+/H+ antiporter Mnh2 subunit F | - |
| F1614_RS05740 | 1192327..1192809 | - | 483 | WP_001832121.1 | Na+/H+ antiporter Mnh2 subunit E | - |
| F1614_RS05745 | 1192806..1194308 | - | 1503 | WP_158171982.1 | Na+/H+ antiporter Mnh2 subunit D | - |
| F1614_RS05750 | 1194298..1194642 | - | 345 | WP_017464480.1 | Na+/H+ antiporter Mnh2 subunit C | - |
| F1614_RS05755 | 1194639..1195064 | - | 426 | WP_002498029.1 | Na+/H+ antiporter Mnh2 subunit B | - |
| F1614_RS05760 | 1195051..1197453 | - | 2403 | WP_017464479.1 | DUF4040 family protein | - |
| F1614_RS05765 | 1198155..1198361 | + | 207 | WP_001832147.1 | hypothetical protein | - |
| F1614_RS05770 | 1198377..1198601 | + | 225 | WP_001832040.1 | DUF2922 domain-containing protein | - |
| F1614_RS05785 | 1198952..1199881 | + | 930 | WP_032605283.1 | DMT family transporter | - |
| F1614_RS05790 | 1200207..1201160 | + | 954 | WP_017464478.1 | hypothetical protein | - |
| F1614_RS05795 | 1201573..1201947 | + | 375 | WP_002457558.1 | global transcriptional regulator SarA | - |
| F1614_RS05800 | 1202120..1202896 | - | 777 | WP_001832174.1 | alpha/beta hydrolase | - |
| F1614_RS05805 | 1203105..1203824 | - | 720 | WP_002456002.1 | hypothetical protein | - |
| F1614_RS05810 | 1204069..1204578 | - | 510 | WP_158171799.1 | hypothetical protein | - |
| F1614_RS05815 | 1204781..1205578 | - | 798 | WP_017464476.1 | alpha/beta fold hydrolase | - |
| F1614_RS05820 | 1205556..1206284 | - | 729 | WP_001832134.1 | HAD family hydrolase | - |
| F1614_RS05825 | 1206343..1207287 | - | 945 | WP_017464475.1 | iron ABC transporter permease | - |
| F1614_RS05830 | 1207564..1208451 | - | 888 | WP_002474363.1 | ABC transporter substrate-binding protein | - |
| F1614_RS05835 | 1208725..1209477 | - | 753 | WP_002493916.1 | MerR family transcriptional regulator | - |
| F1614_RS05840 | 1209532..1210167 | - | 636 | WP_002456006.1 | hypothetical protein | - |
| F1614_RS05845 | 1210424..1212085 | - | 1662 | WP_002438772.1 | arginine--tRNA ligase | - |
| F1614_RS05850 | 1212082..1212498 | - | 417 | WP_001832036.1 | DUF1934 family protein | - |
| F1614_RS05860 | 1212988..1213380 | - | 393 | WP_002477544.1 | hypothetical protein | - |
| F1614_RS05865 | 1213461..1214483 | - | 1023 | WP_002498035.1 | alcohol dehydrogenase AdhP | - |
| F1614_RS05870 | 1214771..1216039 | + | 1269 | WP_002477542.1 | nickel-dependent lactate racemase | - |
| F1614_RS05875 | 1216059..1216886 | + | 828 | WP_199253299.1 | ATP-dependent sacrificial sulfur transferase LarE | - |
| F1614_RS05880 | 1216901..1217677 | + | 777 | WP_002468722.1 | nickel pincer cofactor biosynthesis protein LarB | - |
| F1614_RS05885 | 1217674..1218858 | + | 1185 | WP_017464472.1 | nickel pincer cofactor biosynthesis protein LarC | - |
| F1614_RS05890 | 1218946..1219452 | - | 507 | WP_002474377.1 | YwhD family protein | - |
| F1614_RS05895 | 1219509..1220807 | - | 1299 | WP_002438750.1 | HD domain-containing protein | - |
| F1614_RS05900 | 1220899..1221375 | - | 477 | WP_002474383.1 | GNAT family N-acetyltransferase | - |
| F1614_RS05905 | 1221992..1222930 | - | 939 | WP_158171801.1 | aldo/keto reductase | - |
| F1614_RS05910 | 1223086..1223508 | + | 423 | WP_002468721.1 | Rrf2 family transcriptional regulator | - |
| F1614_RS05915 | 1223513..1224844 | + | 1332 | WP_017464470.1 | FAD-containing oxidoreductase | - |
| F1614_RS05920 | 1225234..1225575 | - | 342 | WP_001832090.1 | DUF1450 domain-containing protein | - |
| F1614_RS05925 | 1225789..1226865 | - | 1077 | WP_017464469.1 | phosphomevalonate kinase | - |
| F1614_RS05930 | 1226878..1227861 | - | 984 | WP_017464468.1 | diphosphomevalonate decarboxylase | - |
| F1614_RS05935 | 1227866..1228786 | - | 921 | WP_158171802.1 | mevalonate kinase | - |
| F1614_RS05940 | 1229490..1230329 | - | 840 | WP_017464467.1 | lipoate--protein ligase family protein | - |
| F1614_RS05945 | 1230329..1231318 | - | 990 | WP_001832032.1 | phosphate acetyltransferase | - |
| F1614_RS05950 | 1231489..1232238 | + | 750 | WP_002474393.1 | heme-dependent peroxidase | - |
| F1614_RS05955 | 1232737..1233501 | + | 765 | WP_001832039.1 | threonine/serine exporter ThrE family protein | - |
| F1614_RS05960 | 1233514..1233966 | + | 453 | WP_001832133.1 | threonine/serine exporter family protein | - |
| F1614_RS05965 | 1234605..1236095 | - | 1491 | WP_002473905.1 | APC family permease | - |
| F1614_RS05970 | 1236211..1236579 | - | 369 | WP_002458376.1 | DUF423 domain-containing protein | - |
| F1614_RS05975 | 1236604..1236963 | - | 360 | WP_001832078.1 | DUF5327 family protein | - |
| F1614_RS05980 | 1236973..1237623 | - | 651 | WP_002473907.1 | uracil-DNA glycosylase | - |
| F1614_RS05985 | 1237789..1238769 | + | 981 | WP_002473906.1 | choloylglycine hydrolase family protein | - |
| F1614_RS05990 | 1238874..1239704 | + | 831 | WP_002458379.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| F1614_RS05995 | 1240519..1240698 | + | 180 | WP_017465214.1 | C1q-binding complement inhibitor VraX | - |
| F1614_RS06000 | 1240989..1242416 | - | 1428 | WP_032605348.1 | MFS transporter | - |
| F1614_RS06005 | 1242599..1242859 | - | 261 | WP_002474114.1 | hypothetical protein | - |
| F1614_RS06010 | 1242863..1243225 | - | 363 | WP_002494194.1 | hypothetical protein | - |
| F1614_RS06015 | 1243191..1244339 | - | 1149 | WP_017465216.1 | acetyl-CoA C-acyltransferase | - |
| F1614_RS06020 | 1244342..1245715 | - | 1374 | WP_059279903.1 | long-chain fatty acid--CoA ligase | - |
| F1614_RS06025 | 1245820..1246467 | - | 648 | WP_017465218.1 | HAD family hydrolase | - |
| F1614_RS06030 | 1246589..1247137 | - | 549 | WP_002474127.1 | 6-phospho-3-hexuloisomerase | - |
| F1614_RS06035 | 1247139..1247771 | - | 633 | WP_001832167.1 | 3-hexulose-6-phosphate synthase | - |
| F1614_RS06040 | 1247881..1248612 | - | 732 | WP_002498050.1 | glucosamine-6-phosphate deaminase | - |
| F1614_RS06045 | 1248897..1249259 | + | 363 | WP_002438722.1 | YojF family protein | - |
| F1614_RS06050 | 1249275..1249940 | + | 666 | WP_017465219.1 | bacillithiol biosynthesis deacetylase BshB2 | - |
| F1614_RS06055 | 1249954..1250832 | + | 879 | WP_017465220.1 | GTP cyclohydrolase I FolE2 | - |
| F1614_RS06065 | 1251261..1252553 | + | 1293 | WP_161935964.1 | arsenite efflux transporter membrane subunit ArsB | - |
| F1614_RS06070 | 1252568..1252966 | + | 399 | WP_158171803.1 | arsenate reductase (thioredoxin) | - |
| F1614_RS06075 | 1253337..1254839 | + | 1503 | WP_158171804.1 | glycosyltransferase | - |
| F1614_RS06080 | 1255208..1258654 | - | 3447 | WP_158171805.1 | fibrinogen-binding adhesin SdrG C-terminal domain-containing protein | - |
| F1614_RS06085 | 1259100..1259666 | - | 567 | WP_017465155.1 | NAD(P)H-dependent oxidoreductase | - |
| F1614_RS06090 | 1259671..1260549 | - | 879 | WP_002474122.1 | Cof-type HAD-IIB family hydrolase | - |
| F1614_RS06100 | 1260718..1261224 | - | 507 | WP_002498057.1 | tRNA adenosine(34) deaminase TadA | - |
| F1614_RS06105 | 1261291..1261908 | + | 618 | WP_002474112.1 | deoxynucleoside kinase | - |
| F1614_RS06110 | 1261901..1262563 | + | 663 | WP_002467913.1 | deoxynucleoside kinase | - |
| F1614_RS06115 | 1262918..1263670 | + | 753 | WP_002474125.1 | 3-oxoacyl-ACP reductase | - |
| F1614_RS06120 | 1263732..1265036 | + | 1305 | WP_017465156.1 | NtaA/DmoA family FMN-dependent monooxygenase | - |
| F1614_RS06125 | 1265125..1265820 | - | 696 | WP_001832318.1 | HAD family hydrolase | - |
| F1614_RS06130 | 1266190..1267884 | - | 1695 | WP_158171806.1 | CDP-glycerol glycerophosphotransferase family protein | - |
| F1614_RS06135 | 1267901..1268932 | - | 1032 | WP_158171807.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| F1614_RS06140 | 1268925..1269641 | - | 717 | WP_002474130.1 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | - |
| F1614_RS06145 | 1269912..1270988 | - | 1077 | WP_002467904.1 | branched-chain amino acid aminotransferase | - |
| F1614_RS06150 | 1271445..1272400 | - | 956 | Protein_1181 | NAD-dependent epimerase/dehydratase family protein | - |
| F1614_RS06155 | 1272659..1272868 | + | 210 | WP_017465158.1 | hypothetical protein | - |
| F1614_RS06160 | 1272956..1273906 | - | 951 | WP_002474121.1 | ornithine cyclodeaminase family protein | - |
| F1614_RS06165 | 1274158..1274667 | - | 510 | WP_002498064.1 | GNAT family N-acetyltransferase | - |
| F1614_RS06170 | 1275240..1276409 | + | 1170 | WP_158171983.1 | amidohydrolase | - |
| F1614_RS06175 | 1276614..1276751 | - | 138 | WP_199253304.1 | hypothetical protein | - |
| F1614_RS06180 | 1277090..1278274 | - | 1185 | WP_001832289.1 | elongation factor Tu | - |
| F1614_RS06185 | 1278493..1280574 | - | 2082 | WP_001832287.1 | elongation factor G | - |
| F1614_RS06190 | 1280694..1281164 | - | 471 | WP_001137495.1 | 30S ribosomal protein S7 | - |
| F1614_RS06195 | 1281235..1281648 | - | 414 | WP_001833079.1 | 30S ribosomal protein S12 | - |
| F1614_RS06200 | 1281739..1281999 | - | 261 | WP_001832275.1 | ribosomal L7Ae/L30e/S12e/Gadd45 family protein | - |
| F1614_RS06205 | 1282327..1285923 | - | 3597 | WP_002438689.1 | DNA-directed RNA polymerase subunit beta' | - |
| F1614_RS06210 | 1286082..1289633 | - | 3552 | WP_001833083.1 | DNA-directed RNA polymerase subunit beta | - |
| F1614_RS06215 | 1289849..1290457 | - | 609 | WP_002495284.1 | class I SAM-dependent methyltransferase | - |
| F1614_RS06220 | 1290649..1291017 | - | 369 | WP_001832283.1 | 50S ribosomal protein L7/L12 | - |
| F1614_RS06225 | 1291055..1291555 | - | 501 | WP_001832306.1 | 50S ribosomal protein L10 | - |
| F1614_RS06235 | 1291830..1292525 | - | 696 | WP_158171809.1 | 50S ribosomal protein L1 | - |
| F1614_RS06240 | 1292738..1293160 | - | 423 | WP_001832298.1 | 50S ribosomal protein L11 | - |
| F1614_RS06245 | 1293492..1294040 | - | 549 | WP_001832303.1 | transcription termination/antitermination protein NusG | - |
| F1614_RS06250 | 1294051..1294233 | - | 183 | WP_002438679.1 | preprotein translocase subunit SecE | - |
| F1614_RS06255 | 1294296..1294439 | - | 144 | WP_001832285.1 | 50S ribosomal protein L33 | - |
| F1614_RS06260 | 1294563..1295138 | - | 576 | WP_002474194.1 | RNA polymerase sigma factor | - |
| F1614_RS06265 | 1295208..1295735 | - | 528 | WP_001832317.1 | NYN domain-containing protein | - |
| F1614_RS06270 | 1295732..1296481 | - | 750 | WP_002494171.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| F1614_RS06275 | 1296489..1296875 | - | 387 | WP_001833082.1 | Mini-ribonuclease 3 | - |
| F1614_RS06280 | 1296880..1298280 | - | 1401 | WP_017465102.1 | cysteine--tRNA ligase | - |
| F1614_RS06285 | 1298264..1298893 | - | 630 | WP_002438669.1 | serine O-acetyltransferase | - |
| F1614_RS06290 | 1299278..1300732 | - | 1455 | WP_017465101.1 | glutamate--tRNA ligase | - |
| F1614_RS06295 | 1301142..1302200 | - | 1059 | WP_158171810.1 | PIN/TRAM domain-containing protein | - |
| F1614_RS06300 | 1302254..1303627 | - | 1374 | WP_002438664.1 | DNA repair protein RadA | - |
| F1614_RS06305 | 1304118..1306571 | - | 2454 | WP_017465099.1 | ATP-dependent Clp protease ATP-binding subunit | - |
| F1614_RS06310 | 1306585..1307592 | - | 1008 | WP_080395241.1 | protein arginine kinase | - |
| F1614_RS06315 | 1307582..1308145 | - | 564 | WP_017465097.1 | UvrB/UvrC motif-containing protein | - |
| F1614_RS06320 | 1308166..1308627 | - | 462 | WP_001832288.1 | CtsR family transcriptional regulator | - |
| F1614_RS06325 | 1308784..1309998 | + | 1215 | WP_017465096.1 | NupC/NupG family nucleoside CNT transporter | - |
| F1614_RS06330 | 1310331..1310888 | - | 558 | WP_032603788.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| F1614_RS06335 | 1310891..1311778 | - | 888 | WP_001830030.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| F1614_RS06340 | 1311875..1313239 | + | 1365 | WP_017465095.1 | PLP-dependent aminotransferase family protein | - |
| F1614_RS06425 | 1325081..1326568 | - | 1488 | WP_158171811.1 | lysine--tRNA ligase | - |
| F1614_RS06430 | 1326915..1327394 | - | 480 | WP_002498815.1 | 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase | - |
| F1614_RS06435 | 1327395..1327760 | - | 366 | WP_002477713.1 | dihydroneopterin aldolase | - |
| F1614_RS06440 | 1327738..1328541 | - | 804 | WP_002498816.1 | dihydropteroate synthase | - |
| F1614_RS06445 | 1328837..1329769 | - | 933 | WP_001832242.1 | cysteine synthase A | - |
| F1614_RS06450 | 1330106..1330987 | - | 882 | WP_158171812.1 | Hsp33 family molecular chaperone HslO | - |
| F1614_RS06455 | 1331242..1333344 | - | 2103 | WP_017465093.1 | ATP-dependent zinc metalloprotease FtsH | - |
| F1614_RS06460 | 1333619..1334158 | - | 540 | WP_002473220.1 | hypoxanthine phosphoribosyltransferase | - |
| F1614_RS06465 | 1334158..1335456 | - | 1299 | WP_158171813.1 | tRNA lysidine(34) synthetase TilS | - |
| F1614_RS06470 | 1335726..1336127 | - | 402 | WP_001832231.1 | RNA-binding protein S1 | - |
| F1614_RS06475 | 1336221..1336622 | - | 402 | WP_002458680.1 | septum formation initiator family protein | - |
| F1614_RS06480 | 1336646..1336909 | - | 264 | WP_002447891.1 | RNA-binding S4 domain-containing protein | - |
| F1614_RS06485 | 1336906..1338096 | - | 1191 | WP_017465091.1 | nucleotide pyrophosphohydrolase | - |
| F1614_RS06490 | 1338093..1339634 | - | 1542 | WP_059279917.1 | polysaccharide biosynthesis protein | - |
| F1614_RS06495 | 1339624..1343124 | - | 3501 | WP_173636533.1 | transcription-repair coupling factor | - |
| F1614_RS06500 | 1343130..1343702 | - | 573 | WP_001832229.1 | aminoacyl-tRNA hydrolase | - |
| F1614_RS06505 | 1343955..1344614 | - | 660 | WP_001832185.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| F1614_RS06510 | 1344784..1345749 | - | 966 | WP_001832233.1 | ribose-phosphate diphosphokinase | - |
| F1614_RS06515 | 1345893..1347248 | - | 1356 | WP_001832214.1 | bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU | - |
| F1614_RS06520 | 1347858..1348166 | - | 309 | WP_001832195.1 | septation regulator SpoVG | - |
| F1614_RS06525 | 1348226..1348606 | - | 381 | WP_001832217.1 | RidA family protein | - |
| F1614_RS06530 | 1348629..1349453 | - | 825 | WP_002468613.1 | pur operon repressor | - |
| F1614_RS06535 | 1349468..1350316 | - | 849 | WP_002477721.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| F1614_RS06540 | 1350709..1350972 | - | 264 | WP_001832193.1 | Veg family protein | - |
| F1614_RS06545 | 1351072..1351962 | - | 891 | WP_002494270.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| F1614_RS06550 | 1351963..1352508 | - | 546 | WP_002447880.1 | ribonuclease M5 | - |
| F1614_RS06555 | 1352715..1353485 | - | 771 | WP_002458670.1 | TatD family hydrolase | - |
| F1614_RS06560 | 1353513..1355483 | - | 1971 | WP_002457101.1 | methionine--tRNA ligase | - |
| F1614_RS06565 | 1355694..1356533 | - | 840 | WP_158171814.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| F1614_RS06570 | 1356535..1356783 | - | 249 | WP_001832208.1 | GIY-YIG nuclease family protein | - |
| F1614_RS06575 | 1356776..1357501 | - | 726 | WP_158171815.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| F1614_RS06580 | 1357597..1357944 | - | 348 | WP_001832238.1 | DNA replication initiation control protein YabA | - |
| F1614_RS06585 | 1357961..1358764 | - | 804 | WP_017465085.1 | stage 0 sporulation family protein | - |
| F1614_RS06590 | 1358766..1359692 | - | 927 | WP_002477725.1 | DNA polymerase III subunit delta' | - |
| F1614_RS06595 | 1359998..1360327 | - | 330 | WP_001832200.1 | cyclic-di-AMP receptor | - |
| F1614_RS06600 | 1360361..1360972 | - | 612 | WP_002473213.1 | dTMP kinase | - |
| F1614_RS06605 | 1360976..1362313 | - | 1338 | WP_002473225.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
| F1614_RS06610 | 1362342..1362875 | - | 534 | WP_002440739.1 | GNAT family N-acetyltransferase | - |
| F1614_RS06630 | 1369051..1369647 | - | 597 | WP_001829377.1 | recombination mediator RecR | - |
| F1614_RS06635 | 1369654..1369971 | - | 318 | WP_002447741.1 | YbaB/EbfC family nucleoid-associated protein | - |
| F1614_RS06640 | 1370060..1371766 | - | 1707 | WP_158171816.1 | DNA polymerase III subunit gamma/tau | - |
| F1614_RS06645 | 1371833..1372363 | - | 531 | WP_001829347.1 | N-acetyltransferase | - |
| F1614_RS06660 | 1373684..1375147 | - | 1464 | WP_158171817.1 | glutamate synthase subunit beta | - |
| F1614_RS06665 | 1375165..1379661 | - | 4497 | WP_158171818.1 | glutamate synthase large subunit | - |
| F1614_RS06670 | 1379853..1380734 | + | 882 | WP_002473343.1 | LysR family transcriptional regulator | - |
| F1614_RS06675 | 1380871..1381983 | + | 1113 | WP_002477457.1 | YibE/F family protein | - |
| F1614_RS06680 | 1381980..1382765 | + | 786 | WP_001829362.1 | YibE/F family protein | - |
| F1614_RS06685 | 1383274..1383660 | - | 387 | WP_002493896.1 | NUDIX domain-containing protein | - |
| F1614_RS06690 | 1383848..1384126 | + | 279 | WP_001829373.1 | hypothetical protein | - |
| F1614_RS06695 | 1384501..1386002 | + | 1502 | Protein_1268 | glycosyltransferase | - |
| F1614_RS06700 | 1386135..1387109 | - | 975 | WP_001829380.1 | autolysin/adhesin Aae | - |
| F1614_RS06705 | 1387634..1388479 | - | 846 | WP_002456836.1 | dipeptide ABC transporter glycylmethionine-binding lipoprotein | - |
| F1614_RS06710 | 1388523..1389182 | - | 660 | WP_001829353.1 | ABC transporter permease | - |
| F1614_RS06715 | 1389185..1390210 | - | 1026 | WP_017464695.1 | methionine ABC transporter ATP-binding protein | - |
| F1614_RS06720 | 1390458..1391603 | - | 1146 | WP_002447726.1 | bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase | - |
| F1614_RS06725 | 1391596..1392504 | - | 909 | WP_002473353.1 | cysteine synthase family protein | - |
| F1614_RS06730 | 1392813..1393352 | + | 540 | WP_002456835.1 | pentapeptide repeat-containing protein | - |
| F1614_RS06735 | 1393529..1394857 | - | 1329 | WP_158171819.1 | sodium-dependent transporter | - |
| F1614_RS06740 | 1395003..1395245 | - | 243 | WP_001829367.1 | hypothetical protein | - |
| F1614_RS06745 | 1395260..1395988 | - | 729 | WP_017464692.1 | alpha/beta fold hydrolase | - |
| F1614_RS06750 | 1396095..1396766 | - | 672 | WP_017464691.1 | phosphatase PAP2 family protein | - |
| F1614_RS06755 | 1397018..1397266 | + | 249 | WP_002473338.1 | hypothetical protein | - |
| F1614_RS06760 | 1397308..1397676 | - | 369 | WP_001829349.1 | DUF2294 domain-containing protein | - |
| F1614_RS06770 | 1397788..1400355 | - | 2568 | WP_158171820.1 | DUF2309 family protein | - |
| F1614_RS06775 | 1400374..1401870 | - | 1497 | WP_158171821.1 | NADH dehydrogenase subunit 5 | - |
| F1614_RS06780 | 1402465..1402533 | + | 69 | WP_096824640.1 | alpha-1/alpha-2 family phenol-soluble modulin | - |
| F1614_RS06785 | 1402624..1402695 | + | 72 | WP_087587975.1 | phenol-soluble modulin PSM-delta | - |
| F1614_RS06790 | 1402939..1403202 | + | 264 | WP_029376565.1 | hypothetical protein | - |
| F1614_RS06795 | 1403441..1404643 | - | 1203 | WP_017464689.1 | GTP-binding protein | - |
| F1614_RS06800 | 1404814..1405197 | - | 384 | WP_017464688.1 | VOC family protein | - |
| F1614_RS06805 | 1405692..1406723 | - | 1032 | WP_002473321.1 | PTS sugar transporter subunit IIC | - |
| F1614_RS06810 | 1407334..1407582 | - | 249 | WP_002491743.1 | hypothetical protein | - |
| F1614_RS06815 | 1407974..1408585 | + | 612 | WP_017464686.1 | hypothetical protein | - |
| F1614_RS06820 | 1409376..1409540 | + | 165 | WP_158000345.1 | helix-turn-helix transcriptional regulator | - |
| F1614_RS06825 | 1410035..1411420 | + | 1386 | WP_017464685.1 | SAP domain-containing protein | - |
| F1614_RS12565 | 1411431..1412634 | + | 1204 | Protein_1294 | site-specific integrase | - |
| F1614_RS06840 | 1412637..1413335 | + | 699 | WP_017464684.1 | DUF3800 domain-containing protein | - |
| F1614_RS06845 | 1413338..1413853 | + | 516 | WP_017464683.1 | hypothetical protein | - |
| F1614_RS06850 | 1414206..1415747 | - | 1542 | WP_059279926.1 | glutamine-hydrolyzing GMP synthase | - |
| F1614_RS06855 | 1415914..1417380 | - | 1467 | WP_002493874.1 | IMP dehydrogenase | - |
| F1614_RS06860 | 1417418..1418686 | - | 1269 | WP_002477437.1 | purine permease | - |
| F1614_RS06865 | 1418686..1419264 | - | 579 | WP_002473345.1 | xanthine phosphoribosyltransferase | - |
| F1614_RS06870 | 1419861..1420268 | + | 408 | WP_002473328.1 | general stress protein | - |
| F1614_RS06875 | 1420397..1421062 | + | 666 | WP_002455897.1 | hypothetical protein | - |
| F1614_RS06880 | 1421188..1422090 | + | 903 | WP_158171822.1 | hypothetical protein | - |
| F1614_RS06885 | 1422399..1423787 | + | 1389 | WP_002493871.1 | L-cystine transporter | - |
| F1614_RS06890 | 1423909..1424664 | - | 756 | WP_017464681.1 | nitroreductase family protein | - |
| F1614_RS06895 | 1424802..1425581 | + | 780 | WP_002473337.1 | hypothetical protein | - |
| F1614_RS06900 | 1426026..1426595 | + | 570 | WP_002447697.1 | peroxiredoxin | - |
| F1614_RS06905 | 1426610..1428133 | + | 1524 | WP_001829382.1 | alkyl hydroperoxide reductase subunit F | - |
| F1614_RS06915 | 1428382..1429005 | + | 624 | WP_002437175.1 | NDxxF motif lipoprotein | - |
| F1614_RS06925 | 1429224..1429601 | + | 378 | WP_017464680.1 | hypothetical protein | - |
| F1614_RS06930 | 1429966..1430556 | - | 591 | WP_002473790.1 | histidine phosphatase family protein | - |
| F1614_RS06935 | 1430577..1431209 | - | 633 | WP_002473807.1 | LysE family translocator | - |
| F1614_RS06945 | 1431685..1431939 | - | 255 | WP_001832461.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| F1614_RS06950 | 1432161..1432421 | + | 261 | WP_002473809.1 | hypothetical protein | - |
| F1614_RS06960 | 1432797..1433039 | - | 243 | WP_001831354.1 | 30S ribosomal protein S18 | - |
| F1614_RS06965 | 1433084..1433593 | - | 510 | WP_002447681.1 | single-stranded DNA-binding protein | - |
| F1614_RS06970 | 1433616..1433912 | - | 297 | WP_001831345.1 | 30S ribosomal protein S6 | - |
| F1614_RS06975 | 1434296..1435104 | + | 809 | Protein_1318 | lysozyme | - |
| F1614_RS06980 | 1435179..1435370 | + | 192 | WP_017464678.1 | hypothetical protein | - |
| F1614_RS06985 | 1435603..1436700 | - | 1098 | WP_017464677.1 | redox-regulated ATPase YchF | - |
| F1614_RS06990 | 1436712..1436915 | - | 204 | WP_001831361.1 | DUF951 domain-containing protein | - |
| F1614_RS06995 | 1436936..1437811 | - | 876 | WP_017464676.1 | mechanosensitive ion channel family protein | - |
| F1614_RS07000 | 1437965..1438807 | - | 843 | WP_002473800.1 | ParB/RepB/Spo0J family partition protein | - |
| F1614_RS07005 | 1439536..1440639 | + | 1104 | WP_001831348.1 | PLP-dependent transferase | - |
| F1614_RS07010 | 1440636..1441811 | + | 1176 | WP_158171823.1 | PLP-dependent aspartate aminotransferase family protein | - |
| F1614_RS07015 | 1441765..1443603 | + | 1839 | WP_002477427.1 | bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase | - |
| F1614_RS07020 | 1443600..1445846 | + | 2247 | WP_158171824.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| F1614_RS07025 | 1445868..1446611 | + | 744 | WP_158171825.1 | cyclase family protein | - |
| F1614_RS07030 | 1446829..1448013 | - | 1185 | WP_158171826.1 | acetyl-CoA C-acetyltransferase | - |
| F1614_RS07035 | 1448029..1448241 | - | 213 | WP_017464674.1 | hypothetical protein | - |
| F1614_RS07040 | 1448857..1449057 | - | 201 | WP_001831332.1 | sterile alpha motif-like domain-containing protein | - |
| F1614_RS07045 | 1449343..1449546 | + | 204 | WP_001831346.1 | helix-turn-helix transcriptional regulator | - |
| F1614_RS07050 | 1449543..1450277 | + | 735 | WP_158171827.1 | DUF3169 family protein | - |
| F1614_RS07055 | 1450305..1451147 | + | 843 | WP_017464672.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07060 | 1451147..1451785 | + | 639 | WP_158171828.1 | ABC-2 transporter permease | - |
| F1614_RS07065 | 1451936..1452166 | + | 231 | WP_001831347.1 | hypothetical protein | - |
| F1614_RS07070 | 1452641..1453105 | + | 465 | WP_002473792.1 | bacillithiol transferase BstA | - |
| F1614_RS07075 | 1453227..1453319 | - | 93 | Protein_1338 | RimJ/RimL family protein N-acetyltransferase | - |
| F1614_RS07080 | 1453310..1453600 | - | 291 | Protein_1339 | helix-turn-helix transcriptional regulator | - |
| F1614_RS07085 | 1453658..1455919 | - | 2262 | WP_017464669.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS07090 | 1456006..1456257 | - | 252 | WP_158171829.1 | glucose-6-phosphate dehydrogenase | - |
| F1614_RS12570 | 1456333..1456575 | + | 243 | Protein_1342 | orotidine 5'-phosphate decarboxylase | - |
| F1614_RS12575 | 1456564..1456779 | + | 216 | Protein_1343 | 6-phospho-3-hexuloisomerase | - |
| F1614_RS07105 | 1457609..1459114 | + | 1506 | WP_017464666.1 | glycosyltransferase | - |
| F1614_RS07110 | 1459190..1460824 | - | 1635 | WP_158171830.1 | poly(glycerol-phosphate) alpha-glucosyltransferase | - |
| F1614_RS07115 | 1460908..1465323 | - | 4416 | WP_158171831.1 | carboxypeptidase regulatory-like domain-containing protein | - |
| F1614_RS07120 | 1466730..1468094 | + | 1365 | WP_017464830.1 | MFS transporter | - |
| F1614_RS07125 | 1468156..1468734 | - | 579 | WP_017464829.1 | signal peptidase I | - |
| F1614_RS07130 | 1468800..1469444 | - | 645 | WP_002494262.1 | hypothetical protein | - |
| F1614_RS07135 | 1469460..1469840 | - | 381 | WP_017464828.1 | hypothetical protein | - |
| F1614_RS07140 | 1470134..1470892 | + | 759 | WP_001831790.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07145 | 1470882..1472762 | + | 1881 | WP_059279931.1 | ABC transporter permease | - |
| F1614_RS07150 | 1472807..1472998 | + | 192 | WP_001831751.1 | hypothetical protein | - |
| F1614_RS07155 | 1473074..1475119 | - | 2046 | WP_017464826.1 | YSIRK-type signal peptide-containing protein | - |
| F1614_RS07160 | 1476138..1476386 | - | 249 | WP_002477406.1 | hypothetical protein | - |
| F1614_RS07165 | 1476765..1477961 | - | 1197 | WP_002494259.1 | ABC transporter permease | - |
| F1614_RS07170 | 1477954..1478640 | - | 687 | WP_001831756.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07175 | 1478637..1479755 | - | 1119 | WP_059279932.1 | RND transporter | - |
| F1614_RS07180 | 1479993..1480622 | + | 630 | WP_158171832.1 | YIP1 family protein | - |
| F1614_RS07185 | 1480911..1481450 | - | 540 | WP_002473363.1 | TetR/AcrR family transcriptional regulator | - |
| F1614_RS07190 | 1481416..1481811 | - | 396 | WP_001831775.1 | DUF3147 family protein | - |
| F1614_RS07195 | 1481827..1482186 | - | 360 | WP_001831810.1 | DUF3147 family protein | - |
| F1614_RS07205 | 1482587..1483426 | - | 840 | WP_001831794.1 | nucleoid occlusion protein | - |
| F1614_RS07210 | 1483470..1484189 | - | 720 | WP_158171833.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| F1614_RS07215 | 1484189..1486066 | - | 1878 | WP_158171834.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
| F1614_RS07220 | 1486139..1487518 | - | 1380 | WP_158171835.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| F1614_RS07225 | 1487664..1488011 | - | 348 | WP_002473495.1 | ribonuclease P protein component | - |
| F1614_RS07230 | 1488170..1488307 | - | 138 | WP_000240855.1 | 50S ribosomal protein L34 | - |
| F1614_RS07235 | 1489057..1490412 | + | 1356 | WP_002455927.1 | chromosomal replication initiator protein DnaA | - |
| F1614_RS07240 | 1490721..1491854 | + | 1134 | WP_002447644.1 | DNA polymerase III subunit beta | - |
| F1614_RS07245 | 1492289..1492525 | + | 237 | WP_017464820.1 | S4 domain-containing protein YaaA | - |
| F1614_RS07250 | 1492522..1493637 | + | 1116 | WP_059279934.1 | DNA replication/repair protein RecF | - |
| F1614_RS07255 | 1493648..1495579 | + | 1932 | WP_001831817.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| F1614_RS07260 | 1495616..1498297 | + | 2682 | WP_059279935.1 | DNA gyrase subunit A | - |
| F1614_RS07265 | 1498689..1499504 | - | 816 | WP_001831762.1 | NAD(P)H-hydrate dehydratase | - |
| F1614_RS07270 | 1500349..1501635 | + | 1287 | WP_002455928.1 | serine--tRNA ligase | - |
| F1614_RS07275 | 1502165..1503148 | - | 984 | WP_017464818.1 | sphingomyelin phosphodiesterase | - |
| F1614_RS07280 | 1503532..1504224 | + | 693 | WP_002477397.1 | AzlC family ABC transporter permease | - |
| F1614_RS07285 | 1504221..1504550 | + | 330 | WP_002456807.1 | AzlD domain-containing protein | - |
| F1614_RS07290 | 1504840..1505808 | + | 969 | WP_001831747.1 | alpha/beta fold hydrolase family protein | - |
| F1614_RS07295 | 1506056..1506982 | + | 927 | WP_002494609.1 | DUF2232 domain-containing protein | - |
| F1614_RS07300 | 1507011..1508978 | + | 1968 | WP_002470520.1 | DHH family phosphoesterase | - |
| F1614_RS07305 | 1508975..1509421 | + | 447 | WP_001831811.1 | 50S ribosomal protein L9 | - |
| F1614_RS07310 | 1509592..1510992 | + | 1401 | WP_059279936.1 | replicative DNA helicase | - |
| F1614_RS07315 | 1511271..1512554 | + | 1284 | WP_002455931.1 | adenylosuccinate synthase | - |
| F1614_RS07335 | 1513606..1514307 | + | 702 | WP_001831816.1 | response regulator transcription factor | - |
| F1614_RS07340 | 1514320..1516152 | + | 1833 | WP_002437327.1 | cell wall metabolism sensor histidine kinase WalK | - |
| F1614_RS07345 | 1516145..1517482 | + | 1338 | WP_002473414.1 | YycH family regulatory protein | - |
| F1614_RS07350 | 1517483..1518274 | + | 792 | WP_002474930.1 | two-component system regulatory protein YycI | - |
| F1614_RS07355 | 1518898..1519698 | + | 801 | WP_002447628.1 | MBL fold metallo-hydrolase | - |
| F1614_RS07360 | 1520753..1521232 | + | 480 | WP_059279938.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| F1614_RS07365 | 1521553..1521726 | - | 174 | Protein_1392 | C39 family peptidase | - |
| F1614_RS07370 | 1521800..1521913 | - | 114 | WP_017465160.1 | bacteriocin | - |
| F1614_RS07375 | 1523231..1523818 | + | 588 | Protein_1394 | hypothetical protein | - |
| F1614_RS07380 | 1523965..1524852 | + | 888 | WP_158171985.1 | hypothetical protein | - |
| F1614_RS07385 | 1524842..1525216 | + | 375 | WP_158171836.1 | hypothetical protein | - |
| F1614_RS07390 | 1525209..1526816 | + | 1608 | WP_017465165.1 | primase | - |
| F1614_RS07395 | 1527045..1528730 | + | 1686 | WP_158171837.1 | recombinase family protein | - |
| F1614_RS07400 | 1528804..1529142 | + | 339 | WP_017465167.1 | hypothetical protein | - |
| F1614_RS07410 | 1529236..1529547 | + | 312 | WP_017465168.1 | hypothetical protein | - |
| F1614_RS07415 | 1529562..1530065 | + | 504 | WP_017465169.1 | DUF1643 domain-containing protein | - |
| F1614_RS07420 | 1530246..1530812 | + | 567 | WP_011274407.1 | peptidase | - |
| F1614_RS07425 | 1530873..1531628 | - | 756 | WP_017465172.1 | hypothetical protein | - |
| F1614_RS07430 | 1531757..1532692 | + | 936 | WP_158171838.1 | abortive infection family protein | - |
| F1614_RS07435 | 1532676..1533068 | + | 393 | WP_017465174.1 | hypothetical protein | - |
| F1614_RS07440 | 1533102..1533437 | + | 336 | WP_017465175.1 | hypothetical protein | - |
| F1614_RS07445 | 1533427..1537962 | + | 4536 | Protein_1407 | DEAD/DEAH box helicase | - |
| F1614_RS12580 | 1539034..1539189 | + | 156 | WP_001830703.1 | hypothetical protein | - |
| F1614_RS07450 | 1539219..1539890 | + | 672 | Protein_1409 | IS6 family transposase | - |
| F1614_RS07455 | 1539975..1540040 | - | 66 | WP_099797811.1 | epsilon family phenol-soluble modulin | - |
| F1614_RS07460 | 1540495..1541208 | - | 714 | WP_001830710.1 | response regulator transcription factor | - |
| F1614_RS07465 | 1541213..1543867 | - | 2655 | WP_017465262.1 | sensor histidine kinase KdpD | - |
| F1614_RS07470 | 1544034..1544114 | + | 81 | WP_001830720.1 | potassium-transporting ATPase subunit F | - |
| F1614_RS07475 | 1544135..1545817 | + | 1683 | WP_017465263.1 | potassium-transporting ATPase subunit A | - |
| F1614_RS07480 | 1545836..1547857 | + | 2022 | WP_029376603.1 | K(+)-transporting ATPase subunit B | - |
| F1614_RS07485 | 1547872..1548432 | + | 561 | WP_001830712.1 | K(+)-transporting ATPase subunit C | - |
| F1614_RS07490 | 1548741..1549082 | - | 342 | WP_017465265.1 | hypothetical protein | - |
| F1614_RS07495 | 1549396..1549791 | + | 396 | Protein_1418 | diaminopimelate epimerase | - |
| F1614_RS07500 | 1549847..1550518 | - | 672 | Protein_1419 | IS6 family transposase | - |
| F1614_RS07505 | 1550588..1551079 | + | 492 | Protein_1420 | IS3 family transposase | - |
| F1614_RS07510 | 1551215..1551448 | - | 234 | WP_002467980.1 | hypothetical protein | - |
| F1614_RS07515 | 1551686..1554787 | + | 3102 | WP_158171839.1 | fibrinogen-binding adhesin SdrG C-terminal domain-containing protein | - |
| F1614_RS07520 | 1554876..1556384 | + | 1509 | WP_017465237.1 | accessory Sec system glycosyltransferase GtfA | - |
| F1614_RS07525 | 1556377..1557696 | + | 1320 | WP_017465238.1 | accessory Sec system glycosylation chaperone GtfB | - |
| F1614_RS07530 | 1557802..1560921 | - | 3120 | Protein_1425 | type I restriction endonuclease subunit R | - |
| F1614_RS07535 | 1560905..1562128 | - | 1224 | WP_017465241.1 | restriction endonuclease subunit S | - |
| F1614_RS07540 | 1562118..1563632 | - | 1515 | WP_158171840.1 | type I restriction-modification system subunit M | - |
| F1614_RS07545 | 1564026..1564949 | + | 924 | WP_145355582.1 | hypothetical protein | - |
| F1614_RS07550 | 1565217..1565570 | - | 354 | WP_017465245.1 | hypothetical protein | - |
| F1614_RS07555 | 1565740..1565841 | - | 102 | WP_002497230.1 | type I toxin-antitoxin system Fst family toxin | - |
| F1614_RS07560 | 1566000..1566347 | - | 348 | WP_002452612.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| F1614_RS07565 | 1566366..1566983 | - | 618 | WP_158171841.1 | CadD family cadmium resistance transporter | - |
| F1614_RS07570 | 1567356..1567787 | - | 432 | WP_017465247.1 | universal stress protein | - |
| F1614_RS07575 | 1567969..1568151 | - | 183 | Protein_1434 | IS6 family transposase | - |
| F1614_RS07580 | 1568405..1568524 | + | 120 | Protein_1435 | LPXTG cell wall anchor domain-containing protein | - |
| F1614_RS07585 | 1568734..1569423 | - | 690 | WP_017465235.1 | hypothetical protein | - |
| F1614_RS07590 | 1569494..1570471 | - | 978 | WP_059279816.1 | DUF1002 domain-containing protein | - |
| F1614_RS07595 | 1570513..1571262 | - | 750 | WP_029376602.1 | hypothetical protein | - |
| F1614_RS07600 | 1571297..1572370 | - | 1074 | WP_017465232.1 | hypothetical protein | - |
| F1614_RS07605 | 1572627..1572941 | + | 315 | Protein_1440 | restriction endonuclease subunit R | - |
| F1614_RS07610 | 1573242..1574795 | - | 1554 | WP_158171842.1 | hypothetical protein | - |
| F1614_RS07615 | 1574961..1577024 | + | 2064 | WP_017465229.1 | copper-translocating P-type ATPase | - |
| F1614_RS07620 | 1577039..1578472 | + | 1434 | WP_059279814.1 | multicopper oxidase domain-containing protein | - |
| F1614_RS07625 | 1578492..1578782 | + | 291 | WP_017465227.1 | YdhK family protein | - |
| F1614_RS07630 | 1578988..1579383 | - | 396 | WP_017465226.1 | arsenate reductase (thioredoxin) | - |
| F1614_RS07635 | 1579400..1580692 | - | 1293 | WP_173636528.1 | arsenite efflux transporter membrane subunit ArsB | - |
| F1614_RS07640 | 1580689..1581006 | - | 318 | WP_002473450.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| F1614_RS07645 | 1581205..1581405 | + | 201 | WP_002473361.1 | hypothetical protein | - |
| F1614_RS07650 | 1581438..1581758 | + | 321 | WP_002473441.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| F1614_RS07655 | 1581846..1582730 | + | 885 | WP_017465224.1 | permease | - |
| F1614_RS07665 | 1583138..1583929 | + | 792 | WP_158171843.1 | HNH endonuclease | - |
| F1614_RS12585 | 1584340..1584498 | - | 159 | WP_002467629.1 | hypothetical protein | - |
| F1614_RS07670 | 1584521..1585126 | - | 606 | WP_017464976.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS07675 | 1585132..1586079 | - | 948 | WP_017464975.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07680 | 1586072..1586902 | - | 831 | WP_158171844.1 | hypothetical protein | - |
| F1614_RS07685 | 1586886..1587925 | - | 1040 | Protein_1456 | radical SAM protein | - |
| F1614_RS07690 | 1587922..1589133 | - | 1212 | WP_158171845.1 | radical SAM protein | - |
| F1614_RS07695 | 1589305..1590210 | + | 906 | WP_001830491.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07700 | 1590185..1591306 | + | 1122 | WP_158171846.1 | hypothetical protein | - |
| F1614_RS07705 | 1591272..1591883 | + | 612 | WP_017464971.1 | hypothetical protein | - |
| F1614_RS07710 | 1591964..1592629 | + | 666 | WP_001830535.1 | response regulator transcription factor | - |
| F1614_RS07715 | 1592617..1593708 | + | 1092 | WP_017464970.1 | HAMP domain-containing histidine kinase | - |
| F1614_RS07725 | 1594648..1596009 | + | 1362 | WP_017464969.1 | MFS transporter | - |
| F1614_RS07730 | 1596274..1597359 | - | 1086 | WP_059279809.1 | ABC transporter permease | - |
| F1614_RS07735 | 1597359..1598084 | - | 726 | WP_017464967.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07740 | 1598226..1598786 | + | 561 | WP_017464966.1 | TetR/AcrR family transcriptional regulator | - |
| F1614_RS07745 | 1599054..1599725 | - | 672 | Protein_1467 | zinc-binding dehydrogenase | - |
| F1614_RS07750 | 1599924..1600709 | + | 786 | WP_059279820.1 | tandem-type lipoprotein | - |
| F1614_RS07755 | 1601019..1601795 | + | 777 | WP_017464962.1 | tandem-type lipoprotein | - |
| F1614_RS07760 | 1601792..1601956 | + | 165 | WP_158000348.1 | hypothetical protein | - |
| F1614_RS07765 | 1602151..1603038 | + | 888 | WP_002455953.1 | mechanosensitive ion channel family protein | - |
| F1614_RS07770 | 1603358..1604362 | + | 1005 | WP_017464961.1 | YqcI/YcgG family protein | - |
| F1614_RS07775 | 1604403..1605044 | + | 642 | WP_002473492.1 | HAD family hydrolase | - |
| F1614_RS07780 | 1605048..1606205 | + | 1158 | WP_017464960.1 | MFS transporter | - |
| F1614_RS07785 | 1606816..1607628 | + | 813 | WP_158171847.1 | HAD-IIB family hydrolase | - |
| F1614_RS07790 | 1607976..1608386 | - | 411 | WP_017464958.1 | DUF1433 domain-containing protein | - |
| F1614_RS07795 | 1608501..1609250 | - | 750 | WP_017464957.1 | hypothetical protein | - |
| F1614_RS07800 | 1609552..1610409 | + | 858 | WP_017464956.1 | hypothetical protein | - |
| F1614_RS07810 | 1610892..1611251 | - | 360 | WP_017464955.1 | hypothetical protein | - |
| F1614_RS07815 | 1611568..1612548 | - | 981 | WP_002473379.1 | tRNA-dihydrouridine synthase | - |
| F1614_RS07820 | 1612748..1614232 | + | 1485 | WP_002477341.1 | malate dehydrogenase (quinone) | - |
| F1614_RS07825 | 1614523..1614644 | + | 122 | Protein_1482 | DUF4176 domain-containing protein | - |
| F1614_RS07830 | 1615170..1615664 | - | 495 | WP_002494012.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| F1614_RS07835 | 1616231..1619350 | + | 3120 | WP_017464953.1 | CDP-glycerol glycerophosphotransferase family protein | - |
| F1614_RS12590 | 1619510..1619620 | + | 111 | Protein_1485 | serine protease | - |
| F1614_RS07840 | 1619826..1619978 | + | 153 | WP_002437688.1 | beta-class phenol-soluble modulin | - |
| F1614_RS07845 | 1620317..1620988 | + | 672 | WP_158171848.1 | dethiobiotin synthase | - |
| F1614_RS07850 | 1620981..1622336 | + | 1356 | WP_158171849.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
| F1614_RS07855 | 1622347..1623480 | + | 1134 | WP_017464949.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| F1614_RS07860 | 1623473..1624159 | + | 687 | WP_017464948.1 | 6-carboxyhexanoate--CoA ligase | - |
| F1614_RS07865 | 1624469..1632201 | + | 7733 | Protein_1491 | putative Ig domain-containing protein | - |
| F1614_RS07870 | 1632370..1632687 | - | 318 | WP_002469284.1 | staphostatin A | - |
| F1614_RS07875 | 1632705..1633892 | - | 1188 | WP_158171850.1 | cysteine protease staphopain | - |
| F1614_RS07880 | 1634385..1636316 | + | 1932 | WP_059279807.1 | YSIRK domain-containing triacylglycerol lipase GehD | - |
| F1614_RS07885 | 1636531..1637322 | + | 792 | WP_017464336.1 | tandem-type lipoprotein | - |
| F1614_RS07890 | 1637471..1638352 | - | 882 | WP_059279806.1 | GTP-binding protein | - |
| F1614_RS07895 | 1638322..1639704 | - | 1383 | WP_017464338.1 | ferrous iron transporter B | - |
| F1614_RS07900 | 1639698..1640804 | - | 1107 | WP_002494023.1 | NAD(P)-binding domain-containing protein | - |
| F1614_RS07905 | 1641061..1642056 | + | 996 | WP_158171851.1 | zinc ABC transporter substrate-binding protein | - |
| F1614_RS07910 | 1642469..1643374 | + | 906 | WP_002473505.1 | FAD:protein FMN transferase | - |
| F1614_RS07915 | 1643457..1646474 | + | 3018 | WP_158171852.1 | NADH-dependent flavin oxidoreductase | - |
| F1614_RS07920 | 1646503..1647879 | + | 1377 | WP_002473364.1 | MFS transporter | - |
| F1614_RS07925 | 1648048..1648821 | + | 774 | WP_001830577.1 | acetoin reductase | - |
| F1614_RS07930 | 1648949..1649638 | - | 690 | WP_002477317.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07935 | 1649653..1650573 | - | 921 | WP_158171853.1 | ABC transporter permease | - |
| F1614_RS07940 | 1650570..1651736 | - | 1167 | WP_158171854.1 | ABC transporter permease | - |
| F1614_RS07945 | 1651895..1653379 | - | 1485 | WP_158171855.1 | hypothetical protein | - |
| F1614_RS07950 | 1653424..1653996 | - | 573 | WP_002477313.1 | DUF5067 domain-containing protein | - |
| F1614_RS07960 | 1654573..1655412 | + | 840 | WP_017464345.1 | histidine racemase CntK | - |
| F1614_RS07965 | 1655409..1656224 | + | 816 | WP_002473498.1 | staphylopine biosynthesis enzyme CntL | - |
| F1614_RS07970 | 1656217..1657509 | + | 1293 | WP_017464346.1 | staphylopine biosynthesis dehydrogenase | - |
| F1614_RS07975 | 1657560..1659158 | + | 1599 | WP_017464347.1 | staphylopine-dependent metal ABC transporter substrate-binding protein CntA | - |
| F1614_RS07980 | 1659171..1660106 | + | 936 | WP_059279804.1 | ABC transporter permease | - |
| F1614_RS07985 | 1660103..1660981 | + | 879 | WP_017464349.1 | ABC transporter permease | - |
| F1614_RS07990 | 1660968..1661783 | + | 816 | WP_002473456.1 | ABC transporter ATP-binding protein | - |
| F1614_RS07995 | 1661776..1662525 | + | 750 | WP_017464350.1 | ABC transporter ATP-binding protein | - |
| F1614_RS08000 | 1662537..1663727 | + | 1191 | WP_017464351.1 | MFS transporter | - |
| F1614_RS08005 | 1664476..1666722 | + | 2247 | WP_002473430.1 | formate C-acetyltransferase | - |
| F1614_RS08010 | 1666744..1667499 | + | 756 | WP_002446860.1 | pyruvate formate lyase-activating protein | - |
| F1614_RS08015 | 1667638..1668855 | - | 1218 | WP_017464352.1 | ArgE/DapE family deacylase | - |
| F1614_RS08020 | 1669203..1670564 | + | 1362 | WP_017464353.1 | branched-chain amino acid transport system II carrier protein | - |
| F1614_RS08025 | 1671031..1671570 | + | 540 | WP_002498100.1 | TetR/AcrR family transcriptional regulator | - |
| F1614_RS08030 | 1671708..1672601 | + | 894 | WP_029376544.1 | 3-keto-5-aminohexanoate cleavage protein | - |
| F1614_RS08035 | 1672601..1673566 | + | 966 | WP_002473392.1 | 3-hydroxybutyryl-CoA dehydrogenase | - |
| F1614_RS08040 | 1673563..1674051 | + | 489 | WP_002498098.1 | thioesterase family protein | - |
| F1614_RS08045 | 1674186..1675373 | + | 1188 | WP_017464356.1 | betaine/proline/choline family ABC transporter ATP-binding protein | - |
| F1614_RS08050 | 1675370..1676005 | + | 636 | WP_002473486.1 | ABC transporter permease | - |
| F1614_RS08055 | 1676024..1676983 | + | 960 | WP_158171856.1 | osmoprotectant ABC transporter substrate-binding protein | - |
| F1614_RS08060 | 1676986..1677633 | + | 648 | WP_002473470.1 | ABC transporter permease | - |
| F1614_RS08065 | 1677674..1678432 | + | 759 | WP_059279802.1 | esterase family protein | - |
| F1614_RS08070 | 1678737..1680293 | - | 1557 | WP_017464358.1 | YfcC family protein | - |
| F1614_RS08075 | 1680467..1681399 | - | 933 | WP_001830533.1 | carbamate kinase | - |
| F1614_RS08080 | 1681422..1682423 | - | 1002 | WP_001830522.1 | ornithine carbamoyltransferase | - |
| F1614_RS08085 | 1682908..1683132 | + | 225 | WP_001830485.1 | hypothetical protein | - |
| F1614_RS08090 | 1683236..1683664 | + | 429 | WP_002473493.1 | FosB family fosfomycin resistance bacillithiol transferase | - |
| F1614_RS08095 | 1683772..1684647 | + | 876 | WP_002494874.1 | 5'-nucleotidase, lipoprotein e(P4) family | - |
| F1614_RS08100 | 1684940..1685899 | + | 960 | WP_173636527.1 | biotin synthase BioB | - |
| F1614_RS08105 | 1686204..1687307 | + | 1104 | WP_002458095.1 | glycerol dehydrogenase | - |
| F1614_RS08110 | 1687323..1688285 | + | 963 | WP_002467644.1 | dihydroxyacetone kinase subunit DhaK | - |
| F1614_RS08115 | 1688340..1688915 | + | 576 | WP_017464360.1 | dihydroxyacetone kinase subunit L | - |
| F1614_RS08120 | 1688919..1689293 | + | 375 | WP_001830585.1 | PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM | - |
| F1614_RS08125 | 1689595..1690191 | - | 597 | WP_002473413.1 | hypothetical protein | - |
| F1614_RS08130 | 1690450..1691652 | - | 1203 | WP_017464361.1 | MFS transporter | - |
| F1614_RS08135 | 1691790..1692686 | + | 897 | WP_158171857.1 | LysR family transcriptional regulator | - |
| F1614_RS08140 | 1692762..1693007 | + | 246 | WP_002473417.1 | hypothetical protein | - |
| F1614_RS08145 | 1693579..1694997 | + | 1419 | WP_002494035.1 | DHA2 family efflux MFS transporter permease subunit | - |
| F1614_RS08150 | 1695036..1695231 | + | 196 | Protein_1547 | single-stranded DNA-binding protein | - |
| F1614_RS08155 | 1695507..1696748 | + | 1242 | WP_002494036.1 | MFS transporter | - |
| F1614_RS08160 | 1696946..1704109 | + | 7164 | WP_017464364.1 | non-ribosomal peptide synthetase | - |
| F1614_RS08165 | 1704119..1704742 | + | 624 | WP_002473427.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
| F1614_RS08170 | 1705112..1707298 | + | 2187 | WP_059279800.1 | YSIRK-type signal peptide-containing protein | - |
| F1614_RS08180 | 1707579..1708919 | + | 1341 | WP_001830529.1 | sugar porter family MFS transporter | - |
| F1614_RS08185 | 1709074..1710777 | + | 1704 | WP_158171858.1 | ABC-ATPase domain-containing protein | - |
| F1614_RS08190 | 1710872..1711369 | + | 498 | WP_002494042.1 | MepB family protein | - |
| F1614_RS08195 | 1711504..1712406 | + | 903 | WP_002494043.1 | EamA family transporter RarD | - |
| F1614_RS08200 | 1712514..1713425 | - | 912 | WP_002477277.1 | ABC transporter substrate-binding protein | - |
| F1614_RS08205 | 1713740..1715158 | - | 1419 | WP_002498085.1 | anion permease | - |
| F1614_RS08210 | 1715484..1716836 | + | 1353 | WP_002494045.1 | dihydrolipoyl dehydrogenase | - |
| F1614_RS08215 | 1716878..1717831 | + | 954 | WP_002473440.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
| F1614_RS08220 | 1717902..1718942 | + | 1041 | WP_158171859.1 | alpha-ketoacid dehydrogenase subunit beta | - |
| F1614_RS08225 | 1718956..1720233 | + | 1278 | WP_017464369.1 | 2-oxo acid dehydrogenase subunit E2 | - |
| F1614_RS08230 | 1720436..1720948 | + | 513 | WP_158171860.1 | hypothetical protein | - |
| F1614_RS08235 | 1721112..1722704 | - | 1593 | WP_002494048.1 | BCCT family transporter | - |
| F1614_RS08240 | 1722885..1723445 | + | 561 | WP_017464370.1 | hypothetical protein | - |
| F1614_RS08245 | 1723479..1724117 | - | 639 | WP_017464371.1 | pyroglutamyl-peptidase I | - |
| F1614_RS08250 | 1724312..1725274 | - | 963 | WP_017464372.1 | rhodanese-related sulfurtransferase | - |
| F1614_RS08255 | 1725563..1726540 | + | 978 | WP_017464373.1 | SMP-30/gluconolactonase/LRE family protein | - |
| F1614_RS08260 | 1726800..1727315 | - | 516 | WP_002473475.1 | YceI family protein | - |
| F1614_RS08270 | 1728543..1730039 | - | 1497 | WP_158171861.1 | malate dehydrogenase (quinone) | - |
| F1614_RS08275 | 1730391..1730908 | + | 518 | Protein_1570 | GNAT family N-acetyltransferase | - |
| F1614_RS08280 | 1731053..1731460 | - | 408 | WP_017464374.1 | YjdF family protein | - |
| F1614_RS08285 | 1731623..1732033 | - | 411 | WP_001829421.1 | Lrp/AsnC family transcriptional regulator | - |
| F1614_RS08290 | 1732136..1732552 | + | 417 | WP_017464375.1 | hypothetical protein | - |
| F1614_RS08295 | 1732789..1733601 | + | 813 | WP_002470288.1 | ATP phosphoribosyltransferase regulatory subunit | - |
| F1614_RS08300 | 1733626..1734240 | + | 615 | WP_002470286.1 | ATP phosphoribosyltransferase | - |
| F1614_RS08305 | 1734233..1735477 | + | 1245 | WP_059279799.1 | histidinol dehydrogenase | - |
| F1614_RS08310 | 1735593..1736171 | + | 579 | WP_002470279.1 | imidazoleglycerol-phosphate dehydratase HisB | - |
| F1614_RS08315 | 1736168..1736746 | + | 579 | WP_002473452.1 | imidazole glycerol phosphate synthase subunit HisH | - |
| F1614_RS08320 | 1736739..1737443 | + | 705 | WP_002494055.1 | 1-(5-phosphoribosyl)-5-((5- phosphoribosylamino)methylideneamino)imidazole-4- carboxamide isomerase | - |
| F1614_RS08325 | 1737440..1738198 | + | 759 | WP_002473514.1 | imidazole glycerol phosphate synthase subunit HisF | - |
| F1614_RS08330 | 1738195..1738830 | + | 636 | WP_002470292.1 | bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE | - |
| F1614_RS08335 | 1738939..1739724 | - | 786 | WP_017464380.1 | arylamine N-acetyltransferase | - |
| F1614_RS08345 | 1740130..1742190 | + | 2061 | WP_158171862.1 | YSIRK domain-containing triacylglycerol lipase GehC | - |
| F1614_RS08350 | 1742385..1743452 | - | 1068 | WP_002484505.1 | polysaccharide intercellular adhesin biosynthesis/export protein IcaC | - |
| F1614_RS08355 | 1743439..1744308 | - | 870 | WP_158171863.1 | intercellular adhesin biosynthesis polysaccharide N-deacetylase | - |
| F1614_RS08360 | 1744305..1744610 | - | 306 | WP_002477257.1 | intracellular adhesion protein D | - |
| F1614_RS08365 | 1744574..1745812 | - | 1239 | WP_017464382.1 | poly-beta-1,6 N-acetyl-D-glucosamine synthase | - |
| F1614_RS08370 | 1745977..1746534 | + | 558 | WP_017464383.1 | TetR family transcriptional regulator | - |
| F1614_RS08380 | 1747969..1749144 | + | 1176 | WP_002437853.1 | MFS transporter | - |
| F1614_RS08385 | 1749244..1750779 | - | 1536 | WP_017464384.1 | bifunctional metallophosphatase/5'-nucleotidase | - |
| F1614_RS08390 | 1750876..1752426 | - | 1551 | WP_158171864.1 | DNA-binding protein | - |
| F1614_RS08395 | 1752661..1753617 | + | 957 | WP_017464385.1 | phosphate/phosphite/phosphonate ABC transporter substrate-binding protein | - |
| F1614_RS08400 | 1753731..1754504 | + | 774 | WP_002470388.1 | phosphonate ABC transporter ATP-binding protein | - |
| F1614_RS08405 | 1754554..1755306 | + | 753 | WP_173636526.1 | phosphonate ABC transporter, permease protein PhnE | - |
| F1614_RS08410 | 1755303..1756118 | + | 816 | WP_002494065.1 | phosphonate ABC transporter, permease protein PhnE | - |
| F1614_RS08415 | 1756394..1757695 | + | 1302 | WP_017464387.1 | hypothetical protein | - |
| F1614_RS08420 | 1758116..1763926 | + | 5811 | WP_158171865.1 | KxYKxGKxW signal peptide domain-containing protein | - |
| F1614_RS08425 | 1764069..1765268 | + | 1200 | WP_001831846.1 | accessory Sec system protein translocase subunit SecY2 | - |
| F1614_RS08430 | 1765286..1766842 | + | 1557 | WP_158171866.1 | accessory Sec system protein Asp1 | - |
| F1614_RS08435 | 1766823..1768391 | + | 1569 | WP_173636525.1 | accessory Sec system protein Asp2 | - |
| F1614_RS08440 | 1768378..1768950 | + | 573 | WP_017465210.1 | accessory Sec system protein Asp3 | - |
| F1614_RS08445 | 1768943..1771333 | + | 2391 | WP_145383806.1 | accessory Sec system translocase SecA2 | - |
| F1614_RS08450 | 1771351..1772859 | + | 1509 | WP_158171867.1 | accessory Sec system glycosyltransferase GtfA | - |
| F1614_RS08455 | 1772852..1774192 | + | 1341 | WP_017465212.1 | accessory Sec system glycosylation chaperone GtfB | - |
| F1614_RS08460 | 1774298..1774645 | + | 348 | WP_002473211.1 | membrane protein | - |
| F1614_RS08465 | 1774815..1775294 | + | 480 | WP_158171868.1 | peptide-methionine (S)-S-oxide reductase | - |
| F1614_RS08470 | 1775443..1775799 | - | 357 | WP_002446941.1 | hypothetical protein | - |
| F1614_RS08475 | 1776140..1777312 | + | 1173 | WP_158171869.1 | MFS transporter | - |
| F1614_RS08480 | 1777474..1778163 | + | 690 | WP_002477236.1 | flavin reductase family protein | - |
| F1614_RS08490 | 1778899..1779075 | - | 177 | WP_001831885.1 | hypothetical protein | - |
| F1614_RS08495 | 1779388..1779816 | - | 429 | WP_001831844.1 | organic hydroperoxide resistance protein | - |
| F1614_RS08500 | 1780066..1782096 | + | 2031 | WP_158171871.1 | LPXTG cell wall anchor domain-containing protein | - |
| F1614_RS08505 | 1782463..1784430 | - | 1968 | WP_002474026.1 | amidase domain-containing protein | - |
| F1614_RS08510 | 1784719..1787577 | + | 2859 | WP_158171872.1 | YhgE/Pip domain-containing protein | - |
| F1614_RS08515 | 1787888..1788838 | - | 951 | WP_002493780.1 | mannose-6-phosphate isomerase, class I | - |
| F1614_RS08520 | 1788854..1790794 | - | 1941 | WP_017464789.1 | fructose-specific PTS transporter subunit EIIC | - |
| F1614_RS08525 | 1790879..1792750 | - | 1872 | WP_158171873.1 | BglG family transcription antiterminator | - |
| F1614_RS08530 | 1793068..1793202 | - | 135 | WP_001831873.1 | beta-class phenol-soluble modulin | - |
| F1614_RS08535 | 1793502..1794281 | + | 780 | WP_001831826.1 | (S)-acetoin forming diacetyl reductase | - |
| F1614_RS08540 | 1794675..1796840 | - | 2166 | WP_145355248.1 | hypothetical protein | - |
| F1614_RS08545 | 1796821..1797747 | - | 927 | WP_158171874.1 | DUF1672 domain-containing protein | - |
| F1614_RS08550 | 1797952..1798407 | - | 456 | WP_199253280.1 | chromate transporter | - |
| F1614_RS08555 | 1798786..1800024 | + | 1239 | WP_032603771.1 | ArgE/DapE family deacylase | - |
| F1614_RS08560 | 1800511..1802034 | + | 1524 | WP_158171875.1 | M4 family metallopeptidase | - |
| F1614_RS08565 | 1802550..1803011 | + | 462 | WP_001831858.1 | ArgR family transcriptional regulator | - |
| F1614_RS08570 | 1803350..1804585 | + | 1236 | WP_002474005.1 | arginine deiminase | - |
| F1614_RS08575 | 1804690..1805697 | + | 1008 | WP_002474039.1 | ornithine carbamoyltransferase | - |
| F1614_RS08580 | 1805962..1807365 | + | 1404 | WP_017464782.1 | arginine-ornithine antiporter | - |
| F1614_RS08585 | 1807611..1808297 | + | 687 | WP_059279791.1 | Crp/Fnr family transcriptional regulator | - |
| F1614_RS08590 | 1808589..1809347 | + | 759 | WP_017464781.1 | esterase family protein | - |
| F1614_RS08595 | 1809601..1810767 | + | 1167 | WP_017464780.1 | CapA family protein | - |
| F1614_RS08605 | 1811115..1812764 | - | 1650 | WP_017464778.1 | alpha-keto acid decarboxylase family protein | - |
| F1614_RS08610 | 1812936..1813382 | + | 447 | WP_158171876.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| F1614_RS08615 | 1813598..1814089 | + | 492 | Protein_1634 | IS200/IS605 family transposase | - |
| F1614_RS08620 | 1814263..1814634 | + | 372 | WP_100208208.1 | DNA/RNA non-specific endonuclease | - |
| F1614_RS08625 | 1814645..1815139 | + | 495 | WP_017464775.1 | TIGR01741 family protein | - |
| F1614_RS08630 | 1816137..1817456 | + | 1320 | WP_002474038.1 | poly-gamma-glutamate hydrolase family protein | - |
| F1614_RS08635 | 1817862..1817963 | + | 102 | WP_002437978.1 | DUF2648 domain-containing protein | - |
| F1614_RS08640 | 1818161..1820494 | + | 2334 | WP_017464774.1 | CDP-glycerol glycerophosphotransferase family protein | - |
| F1614_RS08645 | 1820685..1822229 | + | 1545 | WP_158171877.1 | NAD(P)H-binding protein | - |
| F1614_RS08650 | 1822352..1823821 | - | 1470 | WP_158171878.1 | alkaline phosphatase | - |
| F1614_RS08655 | 1824119..1824298 | + | 180 | WP_002456719.1 | hypothetical protein | - |
| F1614_RS08660 | 1824329..1824994 | + | 666 | WP_017464772.1 | response regulator transcription factor | - |
| F1614_RS08665 | 1825000..1825896 | + | 897 | WP_059279819.1 | sensor histidine kinase | - |
| F1614_RS08670 | 1826007..1826756 | + | 750 | WP_059279789.1 | ABC transporter ATP-binding protein | - |
| F1614_RS08675 | 1826758..1828770 | + | 2013 | WP_017464770.1 | ABC transporter permease | - |
| F1614_RS08680 | 1828874..1829464 | + | 591 | WP_017464769.1 | DUF4064 domain-containing protein | - |
| F1614_RS08685 | 1829986..1831578 | + | 1593 | WP_017464768.1 | solute:sodium symporter family transporter | - |
| F1614_RS08690 | 1831708..1832892 | + | 1185 | WP_001830600.1 | hypothetical protein | - |
| F1614_RS08695 | 1832889..1833998 | + | 1110 | WP_158171879.1 | 5,10-methylene-tetrahydrofolate dehydrogenase | - |
| F1614_RS08700 | 1834143..1835468 | + | 1326 | WP_158171987.1 | PrsW family intramembrane metalloprotease | - |
| F1614_RS08705 | 1835474..1836223 | + | 750 | WP_002474000.1 | zinc ribbon domain-containing protein | - |
| F1614_RS08710 | 1836443..1836883 | + | 441 | WP_002438002.1 | MarR family transcriptional regulator | - |
| F1614_RS08715 | 1836900..1838243 | + | 1344 | WP_158171880.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| F1614_RS08720 | 1838256..1838732 | + | 477 | WP_002438004.1 | glutathione peroxidase | - |
| F1614_RS08730 | 1839048..1839779 | + | 732 | WP_001830661.1 | phosphoadenylyl-sulfate reductase | - |
| F1614_RS08735 | 1840077..1841921 | + | 1845 | WP_017464766.1 | assimilatory sulfite reductase (NADPH) flavoprotein subunit | - |
| F1614_RS08740 | 1841941..1843659 | + | 1719 | WP_017464765.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| F1614_RS08745 | 1843681..1844460 | + | 780 | WP_199253281.1 | uroporphyrinogen-III C-methyltransferase | - |
| F1614_RS08750 | 1844548..1845159 | + | 612 | WP_002474047.1 | NAD(P)-binding protein | - |
| F1614_RS08755 | 1845180..1846076 | + | 897 | WP_158171882.1 | sulfite exporter TauE/SafE family protein | - |
| F1614_RS08760 | 1846100..1847278 | + | 1179 | WP_002438012.1 | sulfate adenylyltransferase | - |
| F1614_RS08765 | 1847294..1847893 | + | 600 | WP_158171883.1 | adenylyl-sulfate kinase | - |
| F1614_RS08770 | 1848236..1848541 | + | 306 | WP_002474037.1 | hypothetical protein | - |
| F1614_RS08775 | 1848860..1850710 | + | 1851 | WP_002497765.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| F1614_RS08780 | 1850707..1851243 | + | 537 | WP_001830592.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
| F1614_RS08785 | 1851606..1852904 | + | 1299 | WP_002497764.1 | anaerobic C4-dicarboxylate transporter | - |
| F1614_RS08795 | 1853326..1854948 | + | 1623 | WP_059279785.1 | BCCT family transporter | - |
| F1614_RS08800 | 1855077..1855214 | - | 138 | WP_168989928.1 | hypothetical protein | - |
| F1614_RS08805 | 1855509..1856072 | - | 564 | WP_017465191.1 | GbsR/MarR family transcriptional regulator | - |
| F1614_RS08810 | 1856553..1858043 | + | 1491 | WP_002474203.1 | betaine-aldehyde dehydrogenase | - |
| F1614_RS08815 | 1858203..1859921 | + | 1719 | WP_001830593.1 | choline dehydrogenase | - |
| F1614_RS08820 | 1860242..1861417 | + | 1176 | WP_017465188.1 | amidohydrolase | - |
| F1614_RS08825 | 1861865..1862083 | + | 219 | WP_002458270.1 | sterile alpha motif-like domain-containing protein | - |
| F1614_RS08830 | 1862111..1862557 | + | 447 | WP_002497761.1 | antibiotic biosynthesis monooxygenase | - |
| F1614_RS08835 | 1862897..1864492 | + | 1596 | WP_158171884.1 | AMP-binding protein | - |
| F1614_RS08840 | 1864827..1867454 | + | 2628 | WP_017465186.1 | pyruvate, phosphate dikinase | - |
| F1614_RS08845 | 1867456..1868274 | + | 819 | WP_001830630.1 | kinase/pyrophosphorylase | - |
| F1614_RS08850 | 1868483..1869982 | + | 1500 | WP_002493814.1 | malate dehydrogenase (quinone) | - |
| F1614_RS08855 | 1870374..1871297 | + | 924 | WP_158171885.1 | hypothetical protein | - |
| F1614_RS08860 | 1871429..1872319 | - | 891 | WP_002493816.1 | fructose bisphosphate aldolase | - |
| F1614_RS08870 | 1872624..1873985 | - | 1362 | WP_017465183.1 | FAD-dependent oxidoreductase | - |
| F1614_RS08875 | 1874608..1874793 | + | 186 | Protein_1683 | IS5/IS1182 family transposase | - |
| F1614_RS08880 | 1874791..1875381 | - | 591 | WP_017465198.1 | hypothetical protein | - |
| F1614_RS08885 | 1875704..1876582 | + | 879 | WP_002497757.1 | hypothetical protein | - |
| F1614_RS08890 | 1876686..1877117 | - | 432 | WP_002497756.1 | hypothetical protein | - |
| F1614_RS08900 | 1877383..1878720 | + | 1338 | WP_017465199.1 | aspartate aminotransferase family protein | - |
| F1614_RS08905 | 1878848..1880299 | - | 1452 | WP_017465200.1 | amino acid permease | - |
| F1614_RS08910 | 1880845..1881726 | + | 882 | WP_001830605.1 | LysR family transcriptional regulator | - |
| F1614_RS08915 | 1882560..1883510 | + | 951 | WP_158171886.1 | L-lactate dehydrogenase | - |
| F1614_RS08920 | 1883573..1885237 | + | 1665 | WP_017465201.1 | acetolactate synthase AlsS | - |
| F1614_RS08925 | 1885349..1886053 | + | 705 | WP_002447055.1 | acetolactate decarboxylase | - |
| F1614_RS08930 | 1886451..1887320 | - | 870 | WP_017465202.1 | oxidoreductase | - |
| F1614_RS08935 | 1887396..1888214 | + | 819 | WP_002473827.1 | 3-methyl-2-oxobutanoate hydroxymethyltransferase | - |
| F1614_RS08940 | 1888207..1889067 | + | 861 | WP_017465203.1 | pantoate--beta-alanine ligase | - |
| F1614_RS08945 | 1889060..1889446 | + | 387 | WP_001830619.1 | aspartate 1-decarboxylase | - |
| F1614_RS08950 | 1889867..1890877 | + | 1011 | WP_158171887.1 | zinc-ribbon domain-containing protein | - |
| F1614_RS08955 | 1890881..1892215 | + | 1335 | Protein_1698 | zinc-ribbon domain-containing protein | - |
| F1614_RS08960 | 1892493..1893209 | + | 717 | WP_001830625.1 | epoxyqueuosine reductase QueH | - |
| F1614_RS08970 | 1893766..1894035 | - | 270 | WP_017465257.1 | hypothetical protein | - |
| F1614_RS08975 | 1894129..1895193 | - | 1065 | WP_002474731.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| F1614_RS08980 | 1895416..1896273 | + | 858 | WP_002474724.1 | fructosamine kinase family protein | - |
| F1614_RS08985 | 1896480..1897859 | + | 1380 | WP_002474729.1 | amino acid permease | - |
| F1614_RS08990 | 1898161..1899219 | + | 1059 | WP_002474727.1 | PTS transporter subunit IIC | - |
| F1614_RS08995 | 1899319..1900743 | + | 1425 | WP_158171888.1 | phosphate--AMP phosphotransferase | - |
| F1614_RS09005 | 1901399..1902106 | + | 708 | WP_002438072.1 | transglycosylase IsaA | - |
| F1614_RS09010 | 1902610..1904418 | + | 1809 | WP_002489287.1 | acetyltransferase | - |
| F1614_RS09015 | 1905017..1905799 | + | 783 | WP_145384002.1 | CHAP domain-containing protein | - |
| F1614_RS09025 | 1906125..1907285 | + | 1161 | WP_017465124.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| F1614_RS09030 | 1907298..1908296 | + | 999 | WP_017465125.1 | D-lactate dehydrogenase | - |
| F1614_RS09035 | 1908350..1908556 | - | 207 | WP_001832344.1 | copper chaperone CopZ | - |
| F1614_RS09040 | 1908688..1911072 | - | 2385 | WP_158171889.1 | heavy metal translocating P-type ATPase | - |
| F1614_RS09045 | 1911309..1911515 | - | 207 | WP_002476994.1 | hypothetical protein | - |
| F1614_RS09050 | 1911717..1912586 | + | 870 | WP_017465127.1 | SDR family oxidoreductase | - |
| F1614_RS09055 | 1913090..1914634 | + | 1545 | WP_002476995.1 | L-glutamate gamma-semialdehyde dehydrogenase | - |
| F1614_RS09060 | 1914935..1915162 | + | 228 | WP_002476996.1 | FeoA domain-containing protein | - |
| F1614_RS09065 | 1915168..1917162 | + | 1995 | WP_158171890.1 | ferrous iron transport protein B | - |
| F1614_RS09070 | 1917177..1917359 | + | 183 | WP_002473315.1 | FeoB-associated Cys-rich membrane protein | - |
| F1614_RS09075 | 1917542..1918006 | + | 465 | WP_002469055.1 | hypothetical protein | - |
| F1614_RS09080 | 1918310..1918828 | + | 519 | WP_017465130.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| F1614_RS09085 | 1919080..1920246 | - | 1167 | WP_002473318.1 | hydroxymethylglutaryl-CoA synthase | - |
| F1614_RS09090 | 1920491..1921768 | + | 1278 | WP_017465131.1 | hydroxymethylglutaryl-CoA reductase, degradative | - |
| F1614_RS09095 | 1921845..1922276 | - | 432 | WP_002438102.1 | CHAP domain-containing protein | - |
| F1614_RS09100 | 1922536..1922751 | - | 216 | WP_002477001.1 | sterile alpha motif-like domain-containing protein | - |
| F1614_RS09105 | 1922939..1923823 | + | 885 | WP_002473301.1 | LysR family transcriptional regulator | - |
| F1614_RS09110 | 1924138..1924530 | + | 393 | WP_002473310.1 | CidA/LrgA family protein | - |
| F1614_RS09115 | 1924527..1925216 | + | 690 | WP_001832367.1 | LrgB family protein | - |
| F1614_RS09120 | 1925266..1927005 | + | 1740 | WP_002473312.1 | pyruvate oxidase | - |
| F1614_RS09125 | 1927249..1929276 | + | 2028 | WP_029376592.1 | glucose-specific PTS transporter subunit IIBC | - |
| F1614_RS09130 | 1929562..1930329 | + | 768 | WP_017465134.1 | CPBP family intramembrane metalloprotease | - |
| F1614_RS09140 | 1930871..1931923 | - | 1053 | WP_017464505.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| F1614_RS09145 | 1932146..1932472 | + | 327 | WP_017464506.1 | thioredoxin family protein | - |
| F1614_RS09150 | 1932655..1933503 | + | 849 | WP_002477007.1 | YitT family protein | - |
| F1614_RS09155 | 1933586..1934566 | + | 981 | WP_002477008.1 | alpha/beta hydrolase | - |
| F1614_RS09160 | 1934638..1934955 | - | 318 | WP_002477009.1 | hypothetical protein | - |
| F1614_RS09165 | 1935406..1936563 | + | 1158 | WP_002490674.1 | poly-gamma-glutamate synthase PgsB | - |
| F1614_RS09170 | 1936565..1937017 | + | 453 | WP_001832320.1 | poly-gamma-glutamate biosynthesis protein PgsC | - |
| F1614_RS09175 | 1937041..1938114 | + | 1074 | WP_017464507.1 | CapA family protein | - |
| F1614_RS09180 | 1938104..1938265 | + | 162 | WP_001832373.1 | hypothetical protein | - |
| F1614_RS09185 | 1938268..1939872 | + | 1605 | WP_002493283.1 | gamma-glutamyltransferase | - |
| F1614_RS09190 | 1940128..1941009 | + | 882 | WP_002493284.1 | GRP family sugar transporter | - |
| F1614_RS09195 | 1941031..1941435 | + | 405 | WP_002477014.1 | D-ribose pyranase | - |
| F1614_RS09200 | 1941489..1942412 | + | 924 | WP_017464508.1 | ribokinase | - |
| F1614_RS09205 | 1942703..1944193 | + | 1491 | WP_158171891.1 | xylulokinase | - |
| F1614_RS09215 | 1944468..1945235 | + | 768 | WP_002474795.1 | hypothetical protein | - |
| F1614_RS09220 | 1945906..1946949 | + | 1044 | WP_002474813.1 | PTS sugar transporter subunit IIC | - |
| F1614_RS09225 | 1946952..1947632 | + | 681 | WP_002493287.1 | L-serine ammonia-lyase, iron-sulfur-dependent subunit beta | - |
| F1614_RS09230 | 1947645..1948544 | + | 900 | WP_001832363.1 | L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha | - |
| F1614_RS09235 | 1948743..1948919 | + | 177 | WP_002438139.1 | hypothetical protein | - |
| F1614_RS09240 | 1948982..1949476 | - | 495 | WP_002474821.1 | GNAT family N-acetyltransferase | - |
| F1614_RS09245 | 1949659..1950270 | + | 612 | WP_017464511.1 | class A sortase SrtA | - |
| F1614_RS09250 | 1950615..1951424 | + | 810 | WP_002477019.1 | Cof-type HAD-IIB family hydrolase | - |
| F1614_RS09255 | 1951611..1952602 | - | 992 | Protein_1753 | D-lactate dehydrogenase | - |
| F1614_RS09260 | 1952848..1953510 | + | 663 | WP_002498454.1 | NAD(P)H-dependent oxidoreductase | - |
| F1614_RS09270 | 1953888..1955381 | + | 1494 | WP_017464512.1 | aldehyde dehydrogenase family protein | - |
| F1614_RS09275 | 1955584..1955889 | + | 306 | WP_017464513.1 | TM2 domain-containing protein | - |
| F1614_RS09280 | 1956262..1957059 | - | 798 | WP_017464514.1 | VOC family protein | - |
| F1614_RS09285 | 1957321..1957602 | - | 282 | WP_001831535.1 | N-acetyltransferase | - |
| F1614_RS09290 | 1957769..1958716 | + | 948 | WP_017464515.1 | zinc ABC transporter substrate-binding protein | - |
| F1614_RS09295 | 1958786..1960210 | - | 1425 | WP_002474777.1 | aldehyde dehydrogenase | - |
| F1614_RS09300 | 1960457..1961506 | - | 1050 | WP_002477024.1 | hypothetical protein | - |
| F1614_RS09310 | 1961854..1963641 | + | 1788 | WP_017464516.1 | sodium:proton antiporter | - |
| F1614_RS09315 | 1963865..1965829 | - | 1965 | WP_158171892.1 | fructose-1,6-bisphosphatase | - |
| F1614_RS09320 | 1966003..1966617 | - | 615 | WP_017464518.1 | DedA family protein | - |
| F1614_RS09325 | 1966725..1967723 | - | 999 | WP_059279775.1 | thiazole biosynthesis adenylyltransferase ThiF | - |
| F1614_RS09330 | 1967725..1968492 | - | 768 | WP_002474796.1 | thiazole synthase | - |
| F1614_RS09335 | 1968494..1968694 | - | 201 | WP_017464520.1 | sulfur carrier protein ThiS | - |
| F1614_RS09340 | 1968678..1969796 | - | 1119 | WP_158171893.1 | glycine oxidase ThiO | - |
| F1614_RS09345 | 1969789..1970388 | - | 600 | WP_080395158.1 | thiamine phosphate synthase | - |
| F1614_RS09350 | 1971060..1972334 | + | 1275 | Protein_1770 | MFS transporter | - |
| F1614_RS09355 | 1972488..1972778 | + | 291 | WP_001831621.1 | antibiotic biosynthesis monooxygenase | - |
| F1614_RS09360 | 1972940..1974853 | + | 1914 | WP_199253282.1 | FUSC family protein | - |
| F1614_RS09365 | 1974927..1975340 | + | 414 | WP_002447130.1 | DUF2188 domain-containing protein | - |
| F1614_RS09370 | 1975604..1976305 | + | 702 | WP_002474791.1 | GTP pyrophosphokinase family protein | - |
| F1614_RS09375 | 1976425..1977342 | - | 918 | WP_017464524.1 | phosphatase PAP2 family protein | - |
| F1614_RS09380 | 1977649..1978518 | + | 870 | Protein_1776 | alpha/beta hydrolase | - |
| F1614_RS09385 | 1978609..1979325 | + | 717 | WP_017464526.1 | MerR family transcriptional regulator | - |
| F1614_RS09390 | 1979483..1980841 | - | 1359 | WP_002477035.1 | glycerol-3-phosphate transporter | - |
| F1614_RS09395 | 1981207..1981887 | + | 681 | WP_002456676.1 | GntR family transcriptional regulator | - |
| F1614_RS09400 | 1981911..1983452 | + | 1542 | WP_017464527.1 | gluconokinase | - |
| F1614_RS09405 | 1983502..1984860 | + | 1359 | WP_001831451.1 | gluconate:H+ symporter | - |
| F1614_RS09410 | 1985109..1985975 | + | 867 | WP_017464528.1 | UTP--glucose-1-phosphate uridylyltransferase GalU | - |
| F1614_RS09415 | 1986188..1987828 | - | 1641 | WP_017464529.1 | phospho-sugar mutase | - |
| F1614_RS09420 | 1988087..1989985 | - | 1899 | WP_017464530.1 | glycosyltransferase family 2 protein | - |
| F1614_RS09425 | 1990144..1990890 | + | 747 | WP_158171894.1 | glycosyltransferase | - |
| F1614_RS09430 | 1991172..1992161 | + | 990 | WP_017464532.1 | DNA (cytosine-5-)-methyltransferase | - |
| F1614_RS09435 | 1992161..1993165 | + | 1005 | WP_158171895.1 | DNA adenine methylase | - |
| F1614_RS09440 | 1993227..1994387 | + | 1161 | WP_158171896.1 | HNH endonuclease | - |
| F1614_RS09445 | 1994488..1994679 | + | 192 | WP_017464535.1 | hypothetical protein | - |
| F1614_RS09450 | 1994961..1995259 | - | 299 | Protein_1790 | DUF1413 domain-containing protein | - |
| F1614_RS09455 | 1995447..1996139 | + | 693 | WP_017464536.1 | SDR family oxidoreductase | - |
| F1614_RS09460 | 1996228..1997481 | + | 1254 | WP_080395155.1 | acetylornithine deacetylase | - |
| F1614_RS09465 | 1997651..1999816 | - | 2166 | WP_158171897.1 | RNA degradosome polyphosphate kinase | - |
| F1614_RS09470 | 1999879..2001411 | - | 1533 | WP_001831486.1 | exopolyphosphatase | - |
| F1614_RS09475 | 2001728..2002546 | + | 819 | WP_002475820.1 | SDR family oxidoreductase | - |
| F1614_RS09480 | 2002709..2002897 | - | 189 | WP_002456665.1 | hypothetical protein | - |
| F1614_RS09485 | 2002914..2003990 | - | 1077 | WP_002484422.1 | M42 family metallopeptidase | - |
| F1614_RS09490 | 2004174..2004641 | + | 468 | WP_017464539.1 | DUF1307 domain-containing protein | - |
| F1614_RS09495 | 2004694..2006271 | - | 1578 | WP_017464540.1 | FMN-binding glutamate synthase family protein | - |
| F1614_RS09500 | 2006416..2007198 | + | 783 | WP_199253283.1 | CPBP family intramembrane metalloprotease | - |
| F1614_RS12595 | 2007227..2007997 | + | 771 | WP_002493307.1 | CPBP family intramembrane metalloprotease | - |
| F1614_RS09510 | 2008293..2008955 | + | 663 | WP_199253284.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS09515 | 2008948..2009724 | + | 777 | WP_002458165.1 | iron export ABC transporter permease subunit FetB | - |
| F1614_RS09520 | 2009863..2011041 | + | 1179 | WP_002474850.1 | MFS transporter | - |
| F1614_RS09525 | 2011124..2012479 | - | 1356 | WP_199253285.1 | carboxylesterase family protein | - |
| F1614_RS09530 | 2012796..2014475 | - | 1680 | WP_002474859.1 | APC family permease | - |
| F1614_RS09535 | 2014659..2015255 | + | 597 | WP_017464543.1 | YdeI family protein | - |
| F1614_RS09540 | 2015320..2016372 | - | 1053 | WP_002474798.1 | 2,3-butanediol dehydrogenase | - |
| F1614_RS09545 | 2016874..2018130 | + | 1257 | WP_017464544.1 | ABC transporter ATP-binding protein | - |
| F1614_RS09550 | 2018133..2018768 | + | 636 | WP_158171901.1 | ABC transporter permease | - |
| F1614_RS09555 | 2018785..2019729 | + | 945 | WP_002474833.1 | osmoprotectant ABC transporter substrate-binding protein | - |
| F1614_RS09560 | 2019729..2020424 | + | 696 | WP_002474797.1 | ABC transporter permease | - |
| F1614_RS09565 | 2020606..2021307 | - | 702 | WP_002474862.1 | antiholin-like protein LrgB | - |
| F1614_RS09570 | 2021311..2021760 | - | 450 | WP_001831627.1 | antiholin-like murein hydrolase modulator LrgA | - |
| F1614_RS09575 | 2021904..2022662 | - | 759 | WP_158171902.1 | response regulator transcription factor LytR | - |
| F1614_RS09580 | 2022643..2024418 | - | 1776 | WP_017464546.1 | sensor histidine kinase | - |
| F1614_RS09585 | 2024843..2026243 | + | 1401 | WP_002498493.1 | MFS transporter | - |
| F1614_RS09590 | 2026669..2027601 | + | 933 | WP_059279770.1 | 2-dehydropantoate 2-reductase | - |
| F1614_RS09595 | 2027724..2028560 | - | 837 | WP_002474857.1 | membrane protein insertase YidC | - |
| F1614_RS09600 | 2028720..2030237 | - | 1518 | WP_017464548.1 | serine hydrolase FLP | - |
| F1614_RS09605 | 2030523..2032352 | + | 1830 | WP_158171903.1 | APC family permease | - |
| F1614_RS09610 | 2032500..2033876 | - | 1377 | WP_017464549.1 | amino acid permease | - |
| F1614_RS09615 | 2034193..2035002 | + | 810 | WP_017464550.1 | metallophosphoesterase | - |
| F1614_RS09620 | 2035065..2035673 | - | 609 | WP_002477063.1 | C39 family peptidase | - |
| F1614_RS09625 | 2035980..2037179 | - | 1200 | WP_017464551.1 | multidrug effflux MFS transporter | - |
| F1614_RS09630 | 2037442..2038143 | - | 702 | WP_002486765.1 | membrane protein | - |
| F1614_RS09635 | 2038174..2039325 | - | 1152 | WP_158171904.1 | glycerate kinase | - |
| F1614_RS09640 | 2039610..2041082 | + | 1473 | WP_158171905.1 | hypothetical protein | - |
| F1614_RS09645 | 2041103..2041489 | + | 387 | WP_001831514.1 | GtrA family protein | - |
| F1614_RS09650 | 2041779..2042660 | + | 882 | WP_002474818.1 | cation diffusion facilitator family transporter | - |
| F1614_RS09655 | 2042936..2043622 | + | 687 | WP_017464553.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| F1614_RS09660 | 2043807..2043911 | - | 105 | WP_002438284.1 | putative metal homeostasis protein | - |
| F1614_RS09665 | 2044126..2044913 | + | 788 | Protein_1833 | transporter substrate-binding domain-containing protein | - |
| F1614_RS09670 | 2044894..2045613 | + | 720 | WP_001831576.1 | amino acid ABC transporter permease | - |
| F1614_RS09675 | 2045610..2046341 | + | 732 | WP_017464554.1 | amino acid ABC transporter ATP-binding protein | - |
| F1614_RS09680 | 2046483..2046620 | - | 138 | WP_173636522.1 | hypothetical protein | - |
| F1614_RS09685 | 2046991..2048238 | - | 1248 | WP_158171906.1 | aminoacyltransferase | - |
| F1614_RS09690 | 2048600..2048962 | + | 363 | WP_002447187.1 | DUF4467 domain-containing protein | - |
| F1614_RS09695 | 2048986..2049582 | + | 597 | WP_017465283.1 | DsbA family protein | - |
| F1614_RS09700 | 2049860..2050330 | + | 471 | WP_017465282.1 | SRPBCC domain-containing protein | - |
| F1614_RS09705 | 2050564..2051385 | + | 822 | WP_017465281.1 | formate/nitrite transporter family protein | - |
| F1614_RS09710 | 2051827..2052363 | + | 537 | WP_017465280.1 | GNAT family N-acetyltransferase | - |
| F1614_RS09720 | 2053102..2054577 | - | 1476 | WP_002502562.1 | ABC transporter substrate-binding protein | - |
| F1614_RS09730 | 2054827..2055546 | + | 720 | WP_001831601.1 | sirohydrochlorin chelatase | - |
| F1614_RS09735 | 2055986..2058391 | + | 2406 | WP_001831596.1 | nitrite reductase large subunit NirB | - |
| F1614_RS09740 | 2058394..2058708 | + | 315 | WP_001831573.1 | nitrite reductase small subunit NirD | - |
| F1614_RS09745 | 2058699..2059634 | + | 936 | WP_017465150.1 | uroporphyrinogen-III C-methyltransferase | - |
| F1614_RS09750 | 2059814..2063497 | + | 3684 | WP_002469197.1 | nitrate reductase subunit alpha | - |
| F1614_RS09755 | 2063487..2065040 | + | 1554 | WP_158171907.1 | nitrate reductase subunit beta | - |
| F1614_RS09760 | 2065018..2065608 | + | 591 | WP_199253286.1 | nitrate reductase molybdenum cofactor assembly chaperone | - |
| F1614_RS09765 | 2065601..2066278 | + | 678 | WP_059279767.1 | respiratory nitrate reductase subunit gamma | - |
| F1614_RS09770 | 2066298..2066750 | + | 453 | WP_002477084.1 | nitrate respiration regulation accessory nitrate sensor NreA | - |
| F1614_RS09775 | 2066760..2067794 | + | 1035 | WP_158171909.1 | sensor histidine kinase | - |
| F1614_RS09780 | 2067823..2068479 | + | 657 | WP_158171910.1 | nitrate respiration regulation response regulator NreC | - |
| F1614_RS09785 | 2068736..2069899 | + | 1164 | WP_001831433.1 | NarK/NasA family nitrate transporter | - |
| F1614_RS09790 | 2070601..2071047 | - | 447 | WP_001831532.1 | MarR family transcriptional regulator | - |
| F1614_RS09795 | 2071211..2071840 | + | 630 | WP_001831480.1 | nitroreductase family protein | - |
| F1614_RS09800 | 2071964..2072329 | + | 366 | WP_001831482.1 | DUF3139 domain-containing protein | - |
| F1614_RS09805 | 2072495..2073775 | + | 1281 | WP_158171911.1 | cation:dicarboxylase symporter family transporter | - |
| F1614_RS09810 | 2074236..2074586 | - | 351 | WP_017464722.1 | DUF4889 domain-containing protein | - |
| F1614_RS09815 | 2074777..2075199 | - | 423 | WP_002474454.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| F1614_RS09820 | 2075272..2077377 | - | 2106 | WP_017464723.1 | AraC family transcriptional regulator Rsp | - |
| F1614_RS09825 | 2078563..2078940 | - | 378 | WP_017464724.1 | YbgA family protein | - |
| F1614_RS09830 | 2079093..2080538 | + | 1446 | WP_158171912.1 | sucrose-specific PTS transporter subunit IIBC | - |
| F1614_RS09835 | 2080628..2081575 | - | 948 | WP_002438349.1 | magnesium transporter CorA family protein | - |
| F1614_RS09840 | 2082190..2083434 | + | 1245 | WP_158171913.1 | copper resistance protein CopC | - |
| F1614_RS09845 | 2083446..2084039 | + | 594 | WP_002474491.1 | YcnI family protein | - |
| F1614_RS09850 | 2084253..2084669 | + | 417 | WP_001831504.1 | DUF2871 domain-containing protein | - |
| F1614_RS09855 | 2084738..2085139 | + | 402 | WP_002474432.1 | GNAT family N-acetyltransferase | - |
| F1614_RS09860 | 2085203..2086195 | - | 993 | WP_002498530.1 | acryloyl-CoA reductase | - |
| F1614_RS09865 | 2086437..2086976 | + | 540 | WP_002477092.1 | GNAT family N-acetyltransferase | - |
| F1614_RS09870 | 2087248..2089413 | + | 2166 | WP_017464729.1 | bifunctional glycosyltransferase family 2 protein/CDP-glycerol:glycerophosphate glycerophosphotransferase | - |
| F1614_RS09875 | 2089542..2090189 | + | 648 | WP_002477094.1 | hypothetical protein | - |
| F1614_RS09880 | 2090321..2092000 | - | 1680 | WP_017464730.1 | CDP-glycerol glycerophosphotransferase family protein | - |
| F1614_RS09885 | 2092350..2093951 | + | 1602 | WP_001831564.1 | L-lactate permease | - |
| F1614_RS09890 | 2094156..2095301 | - | 1146 | WP_002474457.1 | glycosyltransferase family 4 protein | - |
| F1614_RS09895 | 2095633..2097111 | + | 1479 | WP_017464732.1 | malate dehydrogenase (quinone) | - |
| F1614_RS09900 | 2097255..2098610 | - | 1356 | WP_017464733.1 | HAMP domain-containing histidine kinase | - |
| F1614_RS09905 | 2098603..2099277 | - | 675 | WP_059224274.1 | response regulator transcription factor | - |
| F1614_RS09910 | 2099409..2100461 | + | 1053 | WP_002474476.1 | ABC transporter permease | - |
| F1614_RS09915 | 2100461..2101129 | + | 669 | WP_017464735.1 | ABC transporter ATP-binding protein | - |
| F1614_RS09920 | 2101362..2102318 | - | 957 | WP_059279764.1 | YdcF family protein | - |
| F1614_RS09925 | 2102535..2102960 | + | 426 | WP_199253302.1 | MarR family transcriptional regulator | - |
| F1614_RS09930 | 2103240..2104628 | + | 1389 | WP_017464737.1 | zinc-ribbon domain-containing protein | - |
| F1614_RS09935 | 2104683..2105894 | + | 1212 | WP_158171914.1 | multidrug effflux MFS transporter | - |
| F1614_RS09940 | 2105930..2106481 | - | 552 | WP_017464739.1 | TetR/AcrR family transcriptional regulator | - |
| F1614_RS09945 | 2106622..2107269 | + | 648 | WP_002493324.1 | HlyD family secretion protein | - |
| F1614_RS09950 | 2107282..2109258 | + | 1977 | WP_158171915.1 | DHA2 family efflux MFS transporter permease subunit | - |
| F1614_RS09960 | 2109438..2110070 | - | 633 | WP_001831566.1 | hypothetical protein | - |
| F1614_RS09965 | 2110288..2111187 | + | 900 | WP_002498545.1 | alpha/beta hydrolase | - |
| F1614_RS09970 | 2111323..2111712 | - | 390 | WP_002477109.1 | hypothetical protein | - |
| F1614_RS09975 | 2111712..2112191 | - | 480 | WP_059279763.1 | thioesterase family protein | - |
| F1614_RS09980 | 2112298..2113245 | + | 948 | WP_001832877.1 | magnesium/cobalt transporter CorA | - |
| F1614_RS09985 | 2113287..2114336 | + | 1050 | WP_017464744.1 | type 2 isopentenyl-diphosphate Delta-isomerase | - |
| F1614_RS09990 | 2114492..2115700 | - | 1209 | WP_017464745.1 | sodium/glutamate symporter | - |
| F1614_RS09995 | 2116019..2116339 | + | 321 | WP_002474459.1 | PadR family transcriptional regulator | - |
| F1614_RS10000 | 2116336..2116896 | + | 561 | WP_002474436.1 | DUF1700 domain-containing protein | - |
| F1614_RS10005 | 2116893..2117696 | + | 804 | WP_017464746.1 | DUF4097 family beta strand repeat protein | - |
| F1614_RS10010 | 2117850..2118458 | - | 609 | WP_017464747.1 | DNA-3-methyladenine glycosylase | - |
| F1614_RS10015 | 2118665..2119237 | + | 573 | WP_017464748.1 | DUF805 domain-containing protein | - |
| F1614_RS10025 | 2119462..2121072 | - | 1611 | WP_002477115.1 | ribulokinase | - |
| F1614_RS10030 | 2121660..2122670 | + | 1011 | WP_017464749.1 | galactose mutarotase | - |
| F1614_RS10035 | 2122748..2123428 | - | 681 | WP_017464750.1 | MOSC domain-containing protein | - |
| F1614_RS10040 | 2123594..2124286 | + | 693 | WP_017464751.1 | ribose 5-phosphate isomerase A | - |
| F1614_RS12600 | 2124671..2124850 | + | 180 | WP_002477119.1 | hypothetical protein | - |
| F1614_RS10055 | 2125173..2126321 | - | 1149 | WP_002477120.1 | CPBP family intramembrane metalloprotease | - |
| F1614_RS10060 | 2126569..2127504 | + | 936 | WP_002477121.1 | formimidoylglutamase | - |
| F1614_RS10065 | 2127975..2129093 | + | 1119 | WP_158171916.1 | amidohydrolase | - |
| F1614_RS10070 | 2129190..2130071 | + | 882 | WP_158171917.1 | SDR family oxidoreductase | - |
| F1614_RS10075 | 2130196..2130870 | - | 675 | WP_021298942.1 | IS6 family transposase | - |
| F1614_RS10080 | 2130990..2131901 | - | 912 | WP_020368409.1 | metallopeptidase | - |
| F1614_RS10085 | 2131988..2132662 | + | 675 | WP_021298942.1 | IS6 family transposase | - |
| F1614_RS10090 | 2132721..2133251 | + | 531 | Protein_1913 | replication initiation factor domain-containing protein | - |
| F1614_RS10095 | 2133413..2134792 | + | 1380 | WP_000492283.1 | tetracycline efflux MFS transporter Tet(K) | - |
| F1614_RS10100 | 2134981..2136222 | + | 1242 | WP_158171918.1 | plasmid recombination protein | - |
| F1614_RS10105 | 2136749..2137177 | + | 429 | Protein_1916 | replication initiation protein | - |
| F1614_RS10110 | 2137230..2137904 | + | 675 | WP_021298942.1 | IS6 family transposase | - |
| F1614_RS12605 | 2138691..2138858 | + | 168 | WP_002494370.1 | hypothetical protein | - |
| F1614_RS10115 | 2138878..2139264 | + | 387 | WP_002494369.1 | hypothetical protein | - |
| F1614_RS10120 | 2139424..2139873 | - | 450 | WP_002494368.1 | hypothetical protein | - |
| F1614_RS10130 | 2140485..2140880 | - | 396 | WP_002494367.1 | DUF3139 domain-containing protein | - |
| F1614_RS10135 | 2140984..2141352 | + | 369 | WP_002511319.1 | DUF3139 domain-containing protein | - |
| F1614_RS10140 | 2141482..2141847 | + | 366 | WP_158171919.1 | hypothetical protein | - |
| F1614_RS10145 | 2142720..2143325 | + | 606 | WP_186297903.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS10150 | 2143373..2144230 | - | 858 | WP_145356380.1 | RepB family plasmid replication initiator protein | - |
| F1614_RS10155 | 2144781..2145989 | - | 1209 | WP_158171920.1 | plasmid recombination protein | - |
| F1614_RS10160 | 2146444..2146896 | + | 453 | WP_002494373.1 | hypothetical protein | - |
| F1614_RS10165 | 2147487..2147861 | - | 375 | WP_002494371.1 | hypothetical protein | - |
| F1614_RS10170 | 2147976..2148650 | - | 675 | WP_021298942.1 | IS6 family transposase | - |
| F1614_RS10175 | 2148703..2149173 | + | 471 | Protein_1930 | flavin reductase family protein | - |
| F1614_RS10180 | 2149217..2149804 | + | 588 | WP_017464755.1 | hypothetical protein | - |
| F1614_RS10185 | 2150110..2151411 | + | 1302 | WP_017464756.1 | Na+/H+ antiporter NhaC family protein | - |
| F1614_RS10190 | 2151708..2152220 | + | 513 | WP_002457260.1 | SRPBCC domain-containing protein | - |
| F1614_RS10195 | 2152365..2153130 | - | 766 | Protein_1934 | MurR/RpiR family transcriptional regulator | - |
| F1614_RS10200 | 2153328..2154917 | + | 1590 | WP_017464758.1 | alpha-glucoside-specific PTS transporter subunit IIBC | - |
| F1614_RS10205 | 2155022..2155552 | - | 531 | WP_002474475.1 | hypothetical protein | - |
| F1614_RS10210 | 2155854..2156489 | + | 636 | WP_059224240.1 | HAD-IA family hydrolase | - |
| F1614_RS10215 | 2156507..2156695 | + | 189 | WP_002438441.1 | hypothetical protein | - |
| F1614_RS10220 | 2157014..2157199 | - | 186 | WP_001830056.1 | hypothetical protein | - |
| F1614_RS10225 | 2157196..2157552 | - | 357 | WP_017464759.1 | hypothetical protein | - |
| F1614_RS10230 | 2157951..2159327 | + | 1377 | WP_002474431.1 | amino acid permease | - |
| F1614_RS10235 | 2159450..2160322 | - | 873 | WP_002498836.1 | MurR/RpiR family transcriptional regulator | - |
| F1614_RS10240 | 2160336..2161760 | - | 1425 | WP_017464760.1 | PTS transporter subunit EIIC | - |
| F1614_RS10245 | 2161773..2162660 | - | 888 | WP_002438451.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| F1614_RS10250 | 2162657..2163709 | - | 1053 | WP_059279760.1 | DUF871 family protein | - |
| F1614_RS10255 | 2163889..2164224 | - | 336 | WP_002474444.1 | hypothetical protein | - |
| F1614_RS10260 | 2164276..2165022 | + | 747 | WP_017464762.1 | CPBP family intramembrane metalloprotease | - |
| F1614_RS10265 | 2165202..2165891 | - | 690 | WP_017464763.1 | HTH domain-containing protein | - |
| F1614_RS10270 | 2166319..2167089 | + | 771 | WP_158171921.1 | inositol monophosphatase family protein | - |
| F1614_RS10275 | 2167323..2168273 | + | 951 | WP_017464764.1 | LCP family protein | - |
| F1614_RS10285 | 2169062..2169304 | + | 243 | Protein_1951 | DUF1641 domain-containing protein | - |
| F1614_RS10290 | 2169429..2169704 | + | 276 | WP_001830049.1 | hypothetical protein | - |
| F1614_RS10295 | 2169726..2170502 | + | 777 | WP_002498431.1 | N-acetylglucosaminidase | - |
| F1614_RS10300 | 2170885..2172009 | + | 1125 | WP_002474342.1 | FAD-dependent monooxygenase | - |
| F1614_RS10305 | 2172150..2173103 | - | 954 | WP_158171922.1 | 2-hydroxyacid dehydrogenase family protein | - |
| F1614_RS10310 | 2173181..2173498 | - | 318 | WP_002474345.1 | multidrug efflux SMR transporter | - |
| F1614_RS10315 | 2173504..2173830 | - | 327 | WP_001830041.1 | multidrug efflux SMR transporter | - |
| F1614_RS10320 | 2173985..2174458 | - | 474 | WP_002477138.1 | CHAP domain-containing protein | - |
| F1614_RS10325 | 2174782..2175276 | - | 495 | WP_158171923.1 | DUF4870 domain-containing protein | - |
| F1614_RS10330 | 2175657..2176727 | + | 1071 | WP_001830031.1 | NAD/NADP-dependent octopine/nopaline dehydrogenase family protein | - |
| F1614_RS10335 | 2176792..2178189 | + | 1398 | WP_002474341.1 | Na+/H+ antiporter NhaC | - |
| F1614_RS10340 | 2178638..2179411 | - | 774 | WP_059279758.1 | CHAP domain-containing protein | - |
| F1614_RS10345 | 2179984..2181957 | + | 1974 | WP_017465114.1 | helix-turn-helix domain-containing protein | - |
| F1614_RS10350 | 2181996..2182724 | + | 729 | WP_002477669.1 | hypothetical protein | - |
| F1614_RS10355 | 2182760..2183083 | + | 324 | WP_002473869.1 | PH domain-containing protein | - |
| F1614_RS10360 | 2183488..2183832 | + | 345 | WP_002457969.1 | SarA family transcriptional regulator | - |
| F1614_RS10365 | 2183937..2184773 | - | 837 | WP_017465115.1 | urease accessory protein UreD | - |
| F1614_RS10370 | 2184773..2185387 | - | 615 | WP_002498553.1 | urease accessory protein UreG | - |
| F1614_RS10375 | 2185400..2186089 | - | 690 | WP_017465116.1 | urease accessory protein UreF | - |
| F1614_RS10380 | 2186082..2186534 | - | 453 | WP_001832382.1 | urease accessory protein UreE | - |
| F1614_RS10385 | 2186548..2188263 | - | 1716 | WP_158171924.1 | urease subunit alpha | - |
| F1614_RS10390 | 2188266..2188667 | - | 402 | WP_001832383.1 | urease subunit beta | - |
| F1614_RS10395 | 2188681..2188983 | - | 303 | WP_001832402.1 | urease subunit gamma | - |
| F1614_RS10400 | 2189251..2190153 | + | 903 | WP_158171925.1 | urea transporter | - |
| F1614_RS10410 | 2190588..2191730 | + | 1143 | WP_002477664.1 | acyl-CoA/acyl-ACP dehydrogenase | - |
| F1614_RS10415 | 2192049..2192990 | + | 942 | WP_158171926.1 | nucleoside hydrolase | - |
| F1614_RS10420 | 2193100..2193648 | + | 549 | WP_002469013.1 | biotin transporter BioY | - |
| F1614_RS10425 | 2193685..2194440 | + | 756 | WP_017465118.1 | GNAT family N-acetyltransferase | - |
| F1614_RS12610 | 2194589..2195355 | - | 767 | Protein_1979 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
| F1614_RS10440 | 2195575..2196360 | + | 786 | WP_158171927.1 | molybdate ABC transporter substrate-binding protein | - |
| F1614_RS10445 | 2196374..2197045 | + | 672 | WP_001832420.1 | molybdate ABC transporter permease subunit | - |
| F1614_RS10450 | 2197046..2197666 | + | 621 | WP_002467767.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS10455 | 2197742..2198743 | + | 1002 | WP_136627064.1 | ThiF family adenylyltransferase | - |
| F1614_RS10460 | 2198764..2199294 | + | 531 | WP_002473871.1 | MogA/MoaB family molybdenum cofactor biosynthesis protein | - |
| F1614_RS10465 | 2199355..2199843 | - | 489 | WP_001832390.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| F1614_RS10470 | 2199905..2201164 | + | 1260 | WP_158171928.1 | molybdopterin molybdotransferase MoeA | - |
| F1614_RS10475 | 2201161..2201637 | + | 477 | WP_017465122.1 | molybdopterin-guanine dinucleotide biosynthesis protein B | - |
| F1614_RS10480 | 2201638..2202090 | + | 453 | WP_001832409.1 | molybdenum cofactor biosynthesis protein MoaE | - |
| F1614_RS10485 | 2202087..2202320 | + | 234 | WP_001832421.1 | molybdopterin converting factor subunit 1 | - |
| F1614_RS10490 | 2202326..2202931 | + | 606 | WP_158171929.1 | molybdenum cofactor guanylyltransferase MobA | - |
| F1614_RS10495 | 2202944..2203966 | + | 1023 | WP_002473884.1 | GTP 3',8-cyclase MoaA | - |
| F1614_RS10500 | 2204381..2204731 | + | 351 | WP_001832414.1 | SarA family transcriptional regulator | - |
| F1614_RS10505 | 2204750..2205406 | - | 657 | Protein_1993 | transposase | - |
| F1614_RS10510 | 2205795..2206988 | - | 1194 | WP_017465084.1 | MFS transporter | - |
| F1614_RS10515 | 2206988..2207428 | - | 441 | WP_002486253.1 | winged helix DNA-binding protein | - |
| F1614_RS10520 | 2207591..2208352 | + | 762 | WP_158171930.1 | VOC family protein | - |
| F1614_RS10525 | 2208752..2210002 | + | 1251 | WP_002474070.1 | lipid II:glycine glycyltransferase FemX | - |
| F1614_RS10530 | 2210078..2213233 | + | 3156 | WP_017465082.1 | efflux RND transporter permease subunit | - |
| F1614_RS10535 | 2213284..2213601 | - | 318 | WP_002438539.1 | membrane stabilizing protein MspA | - |
| F1614_RS10540 | 2213893..2214063 | - | 171 | WP_002477642.1 | hypothetical protein | - |
| F1614_RS10545 | 2214205..2215113 | + | 909 | WP_017465081.1 | AEC family transporter | - |
| F1614_RS10550 | 2215310..2216101 | - | 792 | WP_002486252.1 | glucose 1-dehydrogenase | - |
| F1614_RS10555 | 2216129..2216992 | - | 864 | WP_001829716.1 | glucose uptake protein GlcU | - |
| F1614_RS10560 | 2217285..2219420 | + | 2136 | WP_158171931.1 | DNA topoisomerase III | - |
| F1614_RS10565 | 2219533..2220867 | + | 1335 | WP_002467747.1 | NCS2 family permease | - |
| F1614_RS10570 | 2220924..2221322 | - | 399 | WP_002474082.1 | hypothetical protein | - |
| F1614_RS10575 | 2221678..2221986 | + | 309 | WP_001118667.1 | 30S ribosomal protein S10 | - |
| F1614_RS10580 | 2222014..2222676 | + | 663 | WP_001829727.1 | 50S ribosomal protein L3 | - |
| F1614_RS10585 | 2222705..2223328 | + | 624 | WP_017465078.1 | 50S ribosomal protein L4 | - |
| F1614_RS10590 | 2223328..2223603 | + | 276 | WP_001829755.1 | 50S ribosomal protein L23 | - |
| F1614_RS10595 | 2223632..2224465 | + | 834 | WP_002447329.1 | 50S ribosomal protein L2 | - |
| F1614_RS10600 | 2224532..2224810 | + | 279 | WP_001829710.1 | 30S ribosomal protein S19 | - |
| F1614_RS10605 | 2224838..2225191 | + | 354 | WP_001829734.1 | 50S ribosomal protein L22 | - |
| F1614_RS10610 | 2225215..2225868 | + | 654 | WP_001829791.1 | 30S ribosomal protein S3 | - |
| F1614_RS10615 | 2225871..2226305 | + | 435 | WP_001829782.1 | 50S ribosomal protein L16 | - |
| F1614_RS10620 | 2226295..2226504 | + | 210 | WP_000644737.1 | 50S ribosomal protein L29 | - |
| F1614_RS10625 | 2226529..2226792 | + | 264 | WP_002432741.1 | 30S ribosomal protein S17 | - |
| F1614_RS10630 | 2226823..2227191 | + | 369 | WP_001829742.1 | 50S ribosomal protein L14 | - |
| F1614_RS10635 | 2227233..2227550 | + | 318 | WP_002474087.1 | 50S ribosomal protein L24 | - |
| F1614_RS10640 | 2227576..2228115 | + | 540 | WP_001829778.1 | 50S ribosomal protein L5 | - |
| F1614_RS10645 | 2228138..2228323 | + | 186 | WP_158171932.1 | type Z 30S ribosomal protein S14 | - |
| F1614_RS10650 | 2228354..2228752 | + | 399 | WP_001829768.1 | 30S ribosomal protein S8 | - |
| F1614_RS10655 | 2228777..2229313 | + | 537 | WP_001829740.1 | 50S ribosomal protein L6 | - |
| F1614_RS10660 | 2229345..2229707 | + | 363 | WP_001829747.1 | 50S ribosomal protein L18 | - |
| F1614_RS10665 | 2229728..2230228 | + | 501 | WP_001829701.1 | 30S ribosomal protein S5 | - |
| F1614_RS10670 | 2230245..2230424 | + | 180 | WP_002432330.1 | 50S ribosomal protein L30 | - |
| F1614_RS10675 | 2230441..2230881 | + | 441 | WP_001829796.1 | 50S ribosomal protein L15 | - |
| F1614_RS10680 | 2230881..2232173 | + | 1293 | WP_001829707.1 | preprotein translocase subunit SecY | - |
| F1614_RS10685 | 2232191..2232838 | + | 648 | WP_002477634.1 | adenylate kinase | - |
| F1614_RS10690 | 2233026..2233244 | + | 219 | WP_001829792.1 | translation initiation factor IF-1 | - |
| F1614_RS10695 | 2233276..2233389 | + | 114 | WP_001829709.1 | 50S ribosomal protein L36 | - |
| F1614_RS10700 | 2233412..2233777 | + | 366 | WP_001829703.1 | 30S ribosomal protein S13 | - |
| F1614_RS10705 | 2233800..2234189 | + | 390 | WP_001829725.1 | 30S ribosomal protein S11 | - |
| F1614_RS10710 | 2234266..2235210 | + | 945 | WP_001829787.1 | DNA-directed RNA polymerase subunit alpha | - |
| F1614_RS10715 | 2235227..2235595 | + | 369 | WP_001829718.1 | 50S ribosomal protein L17 | - |
| F1614_RS10720 | 2235926..2236735 | + | 810 | WP_001829728.1 | energy-coupling factor transporter ATPase | - |
| F1614_RS10725 | 2236732..2237592 | + | 861 | WP_002477632.1 | energy-coupling factor transporter ATPase | - |
| F1614_RS10730 | 2237582..2238388 | + | 807 | WP_158171933.1 | energy-coupling factor transporter transmembrane protein EcfT | - |
| F1614_RS10735 | 2238392..2239195 | + | 804 | WP_002477630.1 | tRNA pseudouridine(38-40) synthase TruA | - |
| F1614_RS10740 | 2239456..2239893 | + | 438 | WP_158171934.1 | 50S ribosomal protein L13 | - |
| F1614_RS10745 | 2239907..2240305 | + | 399 | WP_095694446.1 | 30S ribosomal protein S9 | - |
| F1614_RS10750 | 2240568..2241308 | - | 741 | WP_017465075.1 | NAD-dependent protein deacylase | - |
| F1614_RS10755 | 2241608..2242363 | + | 756 | WP_002474077.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| F1614_RS10760 | 2242734..2243162 | + | 429 | WP_002447342.1 | galactose-6-phosphate isomerase subunit LacA | - |
| F1614_RS10765 | 2243177..2243692 | + | 516 | WP_002457936.1 | galactose-6-phosphate isomerase subunit LacB | - |
| F1614_RS10770 | 2243705..2244637 | + | 933 | WP_158171935.1 | tagatose-6-phosphate kinase | - |
| F1614_RS10775 | 2244641..2245618 | + | 978 | WP_059279754.1 | tagatose-bisphosphate aldolase | - |
| F1614_RS10780 | 2245638..2245952 | + | 315 | WP_001829758.1 | PTS lactose/cellobiose transporter subunit IIA | - |
| F1614_RS10785 | 2245958..2247706 | + | 1749 | WP_002498578.1 | lactose-specific PTS transporter subunit EIIC | - |
| F1614_RS10790 | 2247722..2249134 | + | 1413 | Protein_2050 | 6-phospho-beta-galactosidase | - |
| F1614_RS10795 | 2249405..2250271 | + | 867 | WP_017465111.1 | alpha/beta hydrolase | - |
| F1614_RS10800 | 2250348..2251373 | - | 1026 | WP_199253287.1 | LLM class flavin-dependent oxidoreductase | - |
| F1614_RS10805 | 2251506..2252510 | + | 1005 | WP_017465109.1 | NADP-dependent oxidoreductase | - |
| F1614_RS10810 | 2252609..2253619 | + | 1011 | WP_158171937.1 | zinc-binding alcohol dehydrogenase family protein | - |
| F1614_RS10815 | 2254453..2254989 | + | 537 | WP_001829712.1 | alkaline shock response membrane anchor protein AmaP | - |
| F1614_RS10820 | 2255002..2255241 | + | 240 | WP_001829717.1 | DUF2273 domain-containing protein | - |
| F1614_RS10825 | 2255315..2255815 | + | 501 | WP_002474064.1 | Asp23/Gls24 family envelope stress response protein | - |
| F1614_RS10830 | 2255876..2257837 | - | 1962 | WP_158171938.1 | sialic acid synthase | - |
| F1614_RS10835 | 2257940..2259121 | + | 1182 | WP_001829750.1 | MFS transporter | - |
| F1614_RS10840 | 2259111..2260868 | + | 1758 | WP_158171939.1 | siderophore synthetase | - |
| F1614_RS10845 | 2260872..2261933 | + | 1062 | WP_002474076.1 | alanine/ornithine racemase family PLP-dependent enzyme | - |
| F1614_RS10850 | 2262136..2263131 | + | 996 | WP_002474085.1 | ABC transporter substrate-binding protein | - |
| F1614_RS10855 | 2263143..2264174 | + | 1032 | WP_059279750.1 | iron ABC transporter permease | - |
| F1614_RS10860 | 2264171..2265136 | + | 966 | WP_158171940.1 | iron chelate uptake ABC transporter family permease subunit | - |
| F1614_RS10865 | 2265434..2266807 | + | 1374 | WP_158171941.1 | YjiH family protein | - |
| F1614_RS10870 | 2266984..2267298 | - | 315 | WP_017465105.1 | heme oxygenase | - |
| F1614_RS10875 | 2267451..2267711 | - | 261 | WP_158171942.1 | hypothetical protein | - |
| F1614_RS10880 | 2267888..2268397 | + | 510 | WP_002498585.1 | metal-dependent hydrolase | - |
| F1614_RS10885 | 2268452..2269639 | + | 1188 | WP_158171943.1 | UDPGP type 1 family protein | - |
| F1614_RS10890 | 2269658..2270341 | + | 684 | WP_002474083.1 | hemolysin III family protein | - |
| F1614_RS10895 | 2270580..2271917 | + | 1338 | WP_002474093.1 | MFS transporter | - |
| F1614_RS10900 | 2272110..2272577 | + | 468 | WP_002498586.1 | SepA family multidrug efflux transporter | - |
| F1614_RS10905 | 2272847..2274286 | + | 1440 | WP_002477613.1 | multidrug efflux MFS transporter | - |
| F1614_RS10910 | 2274433..2275500 | + | 1068 | WP_002474092.1 | Mrp/NBP35 family ATP-binding protein | - |
| F1614_RS10960 | 2281542..2282351 | + | 810 | WP_001829928.1 | diadenylate cyclase CdaA | - |
| F1614_RS10965 | 2282352..2283287 | + | 936 | WP_017464721.1 | YbbR-like domain-containing protein | - |
| F1614_RS10970 | 2283312..2284667 | + | 1356 | WP_002457133.1 | phosphoglucosamine mutase | - |
| F1614_RS10975 | 2285300..2287105 | + | 1806 | WP_158171944.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| F1614_RS10980 | 2287592..2288449 | + | 858 | WP_002474615.1 | Cof-type HAD-IIB family hydrolase | - |
| F1614_RS10985 | 2288754..2289905 | - | 1152 | WP_199253288.1 | YtxH domain-containing protein | - |
| F1614_RS10990 | 2290038..2290769 | + | 732 | WP_002494237.1 | metallophosphatase family protein | - |
| F1614_RS10995 | 2291030..2291983 | - | 954 | WP_002474626.1 | CDF family zinc efflux transporter CzrB | - |
| F1614_RS11000 | 2291970..2292311 | - | 342 | WP_017464717.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| F1614_RS11005 | 2292456..2293112 | + | 657 | WP_002477677.1 | SDR family oxidoreductase | - |
| F1614_RS11015 | 2293754..2294692 | + | 939 | WP_002474638.1 | class I mannose-6-phosphate isomerase | - |
| F1614_RS11020 | 2294746..2294973 | + | 228 | WP_002458728.1 | hypothetical protein | - |
| F1614_RS11030 | 2295205..2296581 | + | 1377 | WP_002498859.1 | EVE domain-containing protein | - |
| F1614_RS11035 | 2296762..2297172 | + | 411 | WP_001829885.1 | DUF393 domain-containing protein | - |
| F1614_RS11040 | 2297361..2297807 | + | 447 | WP_001829900.1 | DNA starvation/stationary phase protection protein | - |
| F1614_RS11045 | 2297925..2298635 | - | 711 | WP_002474597.1 | purine-nucleoside phosphorylase | - |
| F1614_RS11050 | 2298842..2299504 | + | 663 | WP_002477681.1 | deoxyribose-phosphate aldolase | - |
| F1614_RS11055 | 2299538..2300839 | + | 1302 | WP_158171945.1 | pyrimidine-nucleoside phosphorylase | - |
| F1614_RS11060 | 2300852..2302039 | + | 1188 | WP_002477683.1 | phosphopentomutase | - |
| F1614_RS11065 | 2302039..2302389 | + | 351 | WP_002498854.1 | membrane protein | - |
| F1614_RS11070 | 2302542..2303012 | - | 471 | WP_002474645.1 | S-ribosylhomocysteine lyase | - |
| F1614_RS11075 | 2303240..2304424 | + | 1185 | WP_001829962.1 | M20 family metallopeptidase | - |
| F1614_RS11080 | 2304424..2305614 | + | 1191 | WP_002477685.1 | hypothetical protein | - |
| F1614_RS11085 | 2305788..2306453 | + | 666 | WP_002477686.1 | DUF2750 domain-containing protein | - |
| F1614_RS11090 | 2306675..2307472 | - | 798 | WP_002494226.1 | type II pantothenate kinase | - |
| F1614_RS11095 | 2307775..2308635 | + | 861 | WP_002477688.1 | GNAT family N-acetyltransferase | - |
| F1614_RS11100 | 2308746..2309282 | + | 537 | WP_158171946.1 | DNA-directed RNA polymerase subunit delta | - |
| F1614_RS11105 | 2309619..2311226 | + | 1608 | WP_002498409.1 | CTP synthase | - |
| F1614_RS11110 | 2311453..2311974 | - | 522 | WP_001829945.1 | DUF2529 domain-containing protein | - |
| F1614_RS11115 | 2312194..2313054 | + | 861 | WP_001829938.1 | fructose-bisphosphate aldolase | - |
| F1614_RS11120 | 2313415..2314674 | + | 1260 | WP_002474631.1 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| F1614_RS11125 | 2315102..2316529 | + | 1428 | WP_158171947.1 | aldehyde dehydrogenase family protein | - |
| F1614_RS11130 | 2316833..2318149 | + | 1317 | WP_001829985.1 | transcription termination factor Rho | - |
| F1614_RS11135 | 2318266..2318523 | + | 258 | WP_001829959.1 | type B 50S ribosomal protein L31 | - |
| F1614_RS11140 | 2318808..2319407 | + | 600 | WP_002498794.1 | thymidine kinase | - |
| F1614_RS11145 | 2319407..2320483 | + | 1077 | WP_158171948.1 | peptide chain release factor 1 | - |
| F1614_RS11150 | 2320470..2321306 | + | 837 | WP_017464713.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| F1614_RS11160 | 2321471..2322514 | + | 1044 | WP_017464712.1 | threonylcarbamoyl-AMP synthase | - |
| F1614_RS11165 | 2322511..2322930 | + | 420 | WP_002474595.1 | low molecular weight protein arginine phosphatase | - |
| F1614_RS11170 | 2323040..2323564 | + | 525 | WP_017464711.1 | TIGR01440 family protein | - |
| F1614_RS11175 | 2323589..2324827 | + | 1239 | WP_158171949.1 | serine hydroxymethyltransferase | - |
| F1614_RS11180 | 2324856..2325485 | + | 630 | WP_001829916.1 | uracil phosphoribosyltransferase | - |
| F1614_RS11185 | 2325510..2326661 | + | 1152 | WP_199253303.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
| F1614_RS11190 | 2326809..2327159 | + | 351 | WP_158171951.1 | ATP synthase subunit I | - |
| F1614_RS11195 | 2327185..2327913 | + | 729 | WP_001829936.1 | F0F1 ATP synthase subunit A | - |
| F1614_RS11200 | 2327956..2328168 | + | 213 | WP_001048816.1 | F0F1 ATP synthase subunit C | - |
| F1614_RS11205 | 2328266..2328781 | + | 516 | WP_001829958.1 | F0F1 ATP synthase subunit B | - |
| F1614_RS11210 | 2328781..2329320 | + | 540 | WP_002498786.1 | F0F1 ATP synthase subunit delta | - |
| F1614_RS11215 | 2329343..2330854 | + | 1512 | WP_001829913.1 | F0F1 ATP synthase subunit alpha | - |
| F1614_RS11220 | 2330939..2331805 | + | 867 | WP_002447784.1 | F0F1 ATP synthase subunit gamma | - |
| F1614_RS11225 | 2331827..2333239 | + | 1413 | WP_001829930.1 | F0F1 ATP synthase subunit beta | - |
| F1614_RS11230 | 2333259..2333663 | + | 405 | WP_002447782.1 | F0F1 ATP synthase subunit epsilon | - |
| F1614_RS11235 | 2333812..2334045 | + | 234 | WP_002456242.1 | DUF1146 family protein | - |
| F1614_RS11240 | 2334155..2335420 | + | 1266 | WP_017464708.1 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| F1614_RS11245 | 2335454..2335891 | + | 438 | WP_158171952.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| F1614_RS11250 | 2336209..2336649 | - | 441 | WP_001829935.1 | YwpF-like family protein | - |
| F1614_RS11255 | 2336840..2337235 | + | 396 | WP_017464707.1 | single-stranded DNA-binding protein | - |
| F1614_RS11260 | 2337623..2338282 | + | 660 | WP_002474611.1 | transglycosylase family protein | - |
| F1614_RS11265 | 2338567..2339256 | + | 690 | WP_017464706.1 | thiaminase II | - |
| F1614_RS11270 | 2339249..2340070 | + | 822 | WP_002498782.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| F1614_RS11275 | 2340063..2340851 | + | 789 | WP_002498781.1 | hydroxyethylthiazole kinase | - |
| F1614_RS11280 | 2340857..2341495 | + | 639 | WP_032605303.1 | thiamine phosphate synthase | - |
| F1614_RS11285 | 2341584..2342456 | + | 873 | WP_158171953.1 | membrane protein insertase YidC | - |
| F1614_RS11290 | 2342562..2343215 | - | 654 | WP_002498779.1 | HD domain-containing protein | - |
| F1614_RS11295 | 2343397..2344881 | - | 1485 | WP_017464703.1 | cardiolipin synthase | - |
| F1614_RS11300 | 2345055..2345348 | + | 294 | WP_001829893.1 | copper-sensing transcriptional repressor CsoR | - |
| F1614_RS11305 | 2345361..2345564 | + | 204 | WP_002474591.1 | heavy-metal-associated domain-containing protein | - |
| F1614_RS11310 | 2345707..2345844 | + | 138 | WP_001829949.1 | hypothetical protein | - |
| F1614_RS11315 | 2345943..2347154 | - | 1212 | WP_002474606.1 | rod shape-determining protein RodA | - |
| F1614_RS11320 | 2347545..2348618 | + | 1074 | WP_158171954.1 | D-alanine--D-alanine ligase | - |
| F1614_RS11325 | 2348630..2349985 | + | 1356 | WP_158171955.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| F1614_RS11330 | 2350286..2351815 | + | 1530 | WP_002457112.1 | DEAD/DEAH box helicase | - |
| F1614_RS11335 | 2352065..2352544 | + | 480 | WP_017464701.1 | PH domain-containing protein | - |
| F1614_RS11340 | 2352537..2354042 | + | 1506 | WP_002474633.1 | PH domain-containing protein | - |
| F1614_RS11345 | 2354029..2354538 | + | 510 | WP_001829888.1 | PH domain-containing protein | - |
| F1614_RS11350 | 2354586..2354939 | + | 354 | WP_001829915.1 | holo-ACP synthase | - |
| F1614_RS11355 | 2355006..2356154 | + | 1149 | WP_002494207.1 | alanine racemase | - |
| F1614_RS11360 | 2356241..2356411 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | - |
| F1614_RS11365 | 2356408..2356770 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| F1614_RS11370 | 2357115..2358116 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
| F1614_RS11375 | 2358216..2358542 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
| F1614_RS11380 | 2358544..2359023 | + | 480 | WP_002474646.1 | anti-sigma B factor RsbW | - |
| F1614_RS11385 | 2358998..2359768 | + | 771 | WP_002474636.1 | RNA polymerase sigma factor SigB | - |
| F1614_RS11390 | 2360058..2362208 | + | 2151 | WP_158171956.1 | RNA-binding transcriptional accessory protein | - |
| F1614_RS11395 | 2362201..2362656 | + | 456 | WP_002498771.1 | SprT family protein | - |
| F1614_RS11435 | 2368969..2370237 | - | 1269 | WP_002474153.1 | threonine ammonia-lyase IlvA | - |
| F1614_RS11440 | 2370252..2370821 | - | 570 | WP_002474184.1 | 3-isopropylmalate dehydratase small subunit | - |
| F1614_RS11445 | 2370822..2372192 | - | 1371 | WP_158171957.1 | 3-isopropylmalate dehydratase large subunit | - |
| F1614_RS11450 | 2372208..2373251 | - | 1044 | WP_002494069.1 | 3-isopropylmalate dehydrogenase | - |
| F1614_RS11455 | 2373248..2374783 | - | 1536 | Protein_2164 | 2-isopropylmalate synthase | - |
| F1614_RS11460 | 2374806..2375810 | - | 1005 | WP_001830020.1 | ketol-acid reductoisomerase | - |
| F1614_RS11465 | 2375928..2376161 | - | 234 | WP_001830009.1 | ACT domain-containing protein | - |
| F1614_RS11470 | 2376161..2377903 | - | 1743 | WP_002494071.1 | biosynthetic-type acetolactate synthase large subunit | - |
| F1614_RS11475 | 2377920..2379608 | - | 1689 | WP_158171958.1 | dihydroxy-acid dehydratase | - |
| F1614_RS11480 | 2380079..2380540 | + | 462 | WP_002474174.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| F1614_RS11485 | 2380521..2381183 | + | 663 | WP_002477469.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
| F1614_RS11490 | 2381156..2381617 | + | 462 | WP_001829994.1 | ribosomal protein S18-alanine N-acetyltransferase | - |
| F1614_RS11495 | 2381614..2382636 | + | 1023 | WP_002494074.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD | - |
| F1614_RS11500 | 2382719..2384335 | - | 1617 | WP_158171959.1 | MutS family DNA mismatch repair protein | - |
| F1614_RS11505 | 2384677..2386611 | - | 1935 | WP_017464896.1 | ABC-F type ribosomal protection protein | - |
| F1614_RS11510 | 2386958..2387593 | + | 636 | WP_002474148.1 | redox-sensing transcriptional repressor Rex | - |
| F1614_RS11515 | 2387733..2388014 | + | 282 | WP_002477473.1 | PH domain-containing protein | - |
| F1614_RS11520 | 2388101..2389153 | + | 1053 | WP_158171960.1 | YeeE/YedE family protein | - |
| F1614_RS11525 | 2389205..2389429 | + | 225 | WP_002469006.1 | sulfurtransferase TusA family protein | - |
| F1614_RS11530 | 2389866..2391116 | + | 1251 | WP_002477475.1 | ammonium transporter | - |
| F1614_RS11535 | 2391252..2392205 | + | 954 | WP_158171961.1 | LacI family DNA-binding transcriptional regulator | - |
| F1614_RS11545 | 2392465..2393937 | + | 1473 | WP_017464899.1 | sucrose-6-phosphate hydrolase | - |
| F1614_RS11550 | 2393944..2394903 | + | 960 | WP_002494080.1 | carbohydrate kinase | - |
| F1614_RS11555 | 2394971..2395687 | - | 717 | WP_001829999.1 | LytTR family DNA-binding domain-containing protein | - |
| F1614_RS11560 | 2395704..2396993 | - | 1290 | WP_017464901.1 | GHKL domain-containing protein | - |
| F1614_RS11565 | 2397020..2397160 | - | 141 | WP_001830021.1 | cyclic lactone autoinducer peptide | - |
| F1614_RS11570 | 2397144..2397728 | - | 585 | WP_001830005.1 | accessory gene regulator AgrB | - |
| F1614_RS11575 | 2398045..2398122 | + | 78 | WP_002494082.1 | delta-hemolysin | - |
| F1614_RS11580 | 2398503..2399288 | - | 786 | WP_002474151.1 | carbon-nitrogen family hydrolase | - |
| F1614_RS11585 | 2399640..2401040 | + | 1401 | WP_199253289.1 | fibrinogen-binding protein | - |
| F1614_RS11590 | 2401099..2401839 | - | 741 | WP_158171963.1 | CPBP family intramembrane metalloprotease | - |
| F1614_RS11595 | 2402014..2402298 | + | 285 | WP_158171964.1 | co-chaperone GroES | - |
| F1614_RS11600 | 2402354..2403973 | + | 1620 | WP_017464903.1 | chaperonin GroEL | - |
| F1614_RS11605 | 2404393..2405559 | + | 1167 | WP_059279954.1 | LPXTG cell wall anchor domain-containing protein | - |
| F1614_RS11610 | 2405989..2407275 | - | 1287 | WP_032605340.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| F1614_RS11615 | 2407750..2407920 | + | 171 | WP_001832481.1 | hypothetical protein | - |
| F1614_RS11620 | 2408239..2408616 | + | 378 | WP_001830364.1 | GntR family transcriptional regulator | - |
| F1614_RS11625 | 2408616..2409530 | + | 915 | WP_002474150.1 | phenol-soluble modulin export ABC transporter ATP-binding protein PmtA | - |
| F1614_RS11630 | 2409511..2410170 | + | 660 | WP_158171965.1 | phenol-soluble modulin export ABC transporter permease subunit PmtB | - |
| F1614_RS11635 | 2410191..2411063 | + | 873 | WP_017465136.1 | phenol-soluble modulin export ABC transporter ATP-binding protein PmtC | - |
| F1614_RS11640 | 2411063..2411794 | + | 732 | WP_002474160.1 | phenol-soluble modulin export ABC transporter permease subunit PmtD | - |
| F1614_RS11645 | 2411925..2412488 | - | 564 | WP_017465137.1 | thioredoxin family protein | - |
| F1614_RS11650 | 2412657..2413142 | + | 486 | WP_029376593.1 | hypothetical protein | - |
| F1614_RS11655 | 2413195..2413752 | + | 558 | WP_017465139.1 | DUF1700 domain-containing protein | - |
| F1614_RS11660 | 2413749..2414585 | + | 837 | WP_017465140.1 | DUF4097 family beta strand repeat protein | - |
| F1614_RS11665 | 2414639..2415679 | - | 1041 | WP_017465141.1 | choloylglycine hydrolase | - |
| F1614_RS11670 | 2416059..2416229 | + | 171 | WP_017465142.1 | hypothetical protein | - |
| F1614_RS11675 | 2416423..2416725 | - | 303 | Protein_2207 | YolD-like family protein | - |
| F1614_RS11680 | 2416909..2418021 | + | 1113 | WP_002457927.1 | tyrosine-type recombinase/integrase | - |
| F1614_RS11685 | 2418024..2420087 | + | 2064 | WP_000026852.1 | tyrosine-type recombinase/integrase | - |
| F1614_RS11690 | 2420096..2420461 | + | 366 | WP_000410574.1 | transposase | - |
| F1614_RS11695 | 2420466..2421835 | + | 1370 | Protein_2211 | hypothetical protein | - |
| F1614_RS11700 | 2421878..2422288 | - | 411 | WP_000612782.1 | YolD-like family protein | - |
| F1614_RS11705 | 2422597..2423442 | - | 846 | WP_158171966.1 | penicillin-hydrolyzing class A beta-lactamase BlaZ | - |
| F1614_RS11710 | 2423549..2425306 | + | 1758 | WP_158171967.1 | beta-lactam sensor/signal transducer BlaR1 | - |
| F1614_RS11715 | 2425296..2425676 | + | 381 | WP_001284657.1 | penicillinase repressor BlaI | - |
| F1614_RS11725 | 2426101..2427129 | + | 1029 | WP_158171968.1 | lactonase family protein | - |
| F1614_RS11730 | 2427241..2428620 | - | 1380 | WP_158171969.1 | aldehyde dehydrogenase | - |
| F1614_RS11735 | 2428920..2429849 | - | 930 | WP_002477580.1 | manganese-dependent inorganic pyrophosphatase | - |
| F1614_RS11740 | 2429904..2430458 | - | 555 | WP_158171970.1 | cysteine hydrolase | - |
| F1614_RS11745 | 2430650..2431747 | + | 1098 | WP_059279957.1 | pectate lyase | - |
| F1614_RS11750 | 2432345..2433148 | - | 804 | WP_017464996.1 | prephenate dehydratase | - |
| F1614_RS11755 | 2433167..2434234 | - | 1068 | WP_002498675.1 | nitric oxide synthase oxygenase | - |
| F1614_RS11760 | 2434426..2435895 | + | 1470 | WP_002474162.1 | nicotinate phosphoribosyltransferase | - |
| F1614_RS11765 | 2435888..2436715 | + | 828 | WP_002474181.1 | ammonia-dependent NAD(+) synthetase | - |
| F1614_RS11770 | 2436789..2437415 | + | 627 | WP_001830398.1 | DUF2179 domain-containing protein | - |
| F1614_RS11775 | 2437399..2437578 | + | 180 | WP_002498672.1 | NETI motif-containing protein | - |
| F1614_RS11780 | 2437990..2439285 | + | 1296 | WP_002440416.1 | adenylosuccinate lyase | - |
| F1614_RS11785 | 2439410..2439712 | + | 303 | WP_001830443.1 | hypothetical protein | - |
| F1614_RS11790 | 2440036..2440728 | + | 693 | WP_158171971.1 | heptaprenylglyceryl phosphate synthase | - |
| F1614_RS11795 | 2440725..2442914 | + | 2190 | WP_059279958.1 | DNA helicase PcrA | - |
| F1614_RS11800 | 2442918..2444915 | + | 1998 | WP_017464999.1 | NAD-dependent DNA ligase LigA | - |
| F1614_RS11805 | 2444935..2446143 | + | 1209 | WP_001830442.1 | CamS family sex pheromone protein | - |
| F1614_RS11810 | 2446470..2448005 | - | 1536 | WP_158171972.1 | sodium/proline symporter PutP | - |
| F1614_RS11815 | 2448383..2448685 | + | 303 | WP_002457086.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC | - |
| F1614_RS11820 | 2448687..2450144 | + | 1458 | WP_017465001.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA | - |
| F1614_RS11825 | 2450157..2451584 | + | 1428 | WP_002457087.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB | - |
| F1614_RS11830 | 2451809..2452759 | + | 951 | WP_002473921.1 | diacylglycerol kinase | - |
| F1614_RS11835 | 2452839..2454209 | + | 1371 | WP_017465002.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| F1614_RS11840 | 2454353..2454895 | + | 543 | WP_017465003.1 | DUF3267 domain-containing protein | - |
| F1614_RS11845 | 2455206..2456276 | + | 1071 | WP_002477592.1 | DNA polymerase IV | - |
| F1614_RS11850 | 2456307..2456861 | - | 555 | WP_002473920.1 | 3'-5' exonuclease | - |
| F1614_RS11855 | 2457050..2457550 | - | 501 | WP_001830392.1 | H-type ferritin FtnA | - |
| F1614_RS11860 | 2457772..2459085 | + | 1314 | WP_017465004.1 | Mur ligase family protein | - |
| F1614_RS11865 | 2459087..2459812 | + | 726 | WP_017465005.1 | glutamine amidotransferase | - |
| F1614_RS11870 | 2460251..2460787 | + | 537 | WP_017465007.1 | hypothetical protein | - |
| F1614_RS11875 | 2460938..2461924 | - | 987 | WP_002457091.1 | aromatic acid exporter family protein | - |
| F1614_RS11880 | 2462098..2462853 | + | 756 | WP_002494126.1 | type I methionyl aminopeptidase | - |
| F1614_RS11885 | 2463011..2463397 | + | 387 | WP_017465009.1 | hypothetical protein | - |
| F1614_RS11890 | 2463412..2464113 | + | 702 | WP_002473931.1 | transporter | - |
| F1614_RS11895 | 2464110..2465156 | + | 1047 | WP_002494127.1 | sensor histidine kinase | - |
| F1614_RS11900 | 2465146..2465775 | + | 630 | WP_002473914.1 | two-component system response regulator VraR | - |
| F1614_RS11905 | 2465832..2467010 | - | 1179 | WP_021298785.1 | YihY/virulence factor BrkB family protein | - |
| F1614_RS11910 | 2467417..2467701 | - | 285 | WP_002473916.1 | YtxH domain-containing protein | - |
| F1614_RS11915 | 2467709..2468173 | - | 465 | WP_002498659.1 | low molecular weight phosphotyrosine protein phosphatase | - |
| F1614_RS11920 | 2468314..2468529 | + | 216 | WP_001830421.1 | DUF1128 domain-containing protein | - |
| F1614_RS11925 | 2468531..2469772 | + | 1242 | WP_017465013.1 | aminopeptidase | - |
| F1614_RS11930 | 2469852..2470382 | + | 531 | WP_002447436.1 | acyl-CoA thioesterase | - |
| F1614_RS11935 | 2470520..2471659 | - | 1140 | WP_162196377.1 | radical SAM/CxCxxxxC motif protein YfkAB | - |
| F1614_RS11940 | 2471822..2471983 | + | 162 | WP_001830395.1 | hypothetical protein | - |
| F1614_RS11945 | 2472400..2472918 | + | 519 | WP_002447434.1 | type 1 glutamine amidotransferase | - |
| F1614_RS11950 | 2473235..2474044 | + | 810 | WP_017465288.1 | monofunctional peptidoglycan glycosyltransferase SgtB | - |
| F1614_RS11955 | 2474322..2475125 | + | 804 | WP_002473937.1 | recombination regulator RecX | - |
| F1614_RS11960 | 2475118..2475432 | + | 315 | WP_017465287.1 | YfhH family protein | - |
| F1614_RS11965 | 2475448..2476965 | + | 1518 | WP_158171973.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS11970 | 2476974..2477810 | + | 837 | WP_002477607.1 | hypothetical protein | - |
| F1614_RS11975 | 2477995..2478969 | - | 975 | WP_002473915.1 | metal-dependent hydrolase | - |
| F1614_RS11980 | 2479150..2480193 | + | 1044 | WP_017465258.1 | A/G-specific adenine glycosylase | - |
| F1614_RS11985 | 2480300..2480842 | + | 543 | WP_001830384.1 | DUF402 domain-containing protein | - |
| F1614_RS11990 | 2481084..2482820 | + | 1737 | WP_002473922.1 | ABC transporter ATP-binding protein/permease | - |
| F1614_RS11995 | 2482979..2484073 | - | 1095 | WP_002494296.1 | aromatic acid exporter family protein | - |
| F1614_RS12000 | 2484380..2485669 | - | 1290 | WP_017465261.1 | glutamate-1-semialdehyde 2,1-aminomutase | - |
| F1614_RS12005 | 2485751..2486209 | + | 459 | WP_001830449.1 | thioredoxin-dependent thiol peroxidase | - |
| F1614_RS12010 | 2486212..2487162 | + | 951 | WP_158171974.1 | phosphoglycerate dehydrogenase | - |
| F1614_RS12015 | 2487258..2487710 | + | 453 | WP_002473927.1 | peroxide-responsive transcriptional repressor PerR | - |
| F1614_RS12175 | 2496216..2497064 | + | 849 | WP_002474589.1 | serine protease | - |
| F1614_RS12180 | 2497292..2498350 | + | 1059 | WP_002456347.1 | PTS transporter subunit IIC | - |
| F1614_RS12185 | 2498589..2500046 | + | 1458 | WP_158171975.1 | ABC transporter substrate-binding protein/permease | - |
| F1614_RS12190 | 2500039..2500761 | + | 723 | WP_017465289.1 | ATP-binding cassette domain-containing protein | - |
| F1614_RS12200 | 2501625..2502755 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| F1614_RS12205 | 2502752..2503222 | + | 471 | WP_002474494.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7084.66 Da Isoelectric Point: 4.3016
>T139365 WP_002474496.1 NZ_CP043847:487-669 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQTHDNEVRSDFKNSK
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQTHDNEVRSDFKNSK
Download Length: 183 bp
>T139365 NZ_CP058656:3429267-3429485 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTTTGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTTTGGAAATTTATTCGCTAA
Antitoxin
Download Length: -834305.33333333 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT139365 WP_002476983.1 NZ_CP043847:2503380-463 [Staphylococcus epidermidis]
Download Length: -2502916 bp
>AT139365 NZ_CP058656:3428867-3429241 [Escherichia coli]
ATGGATGAATACTCACCCAAAAGACATGATATCGCACAGCTTAAGTTTCTCTGTGAAACCCTGTATCATGACTGCCTTGC
AAACCTTGAAGAAAGCAATCATGGCTGGGTTAACGACCCAACCTCGGCGATCAACCTCCAGTTGAATGAACTGATTGAGC
ATATTGCGACCTTCGCACTTAATTACAAAATTAAGTATAATGAAGACAATAAGCTCATTGAGCAGATCGACGAATATCTG
GATGACACCTTTATGTTGTTCAGTAGTTATGGTATTAATATGCAGGATCTTCAGAAATGGCGGAAGTCAGGTAATCGACT
ATTCCGTTGTTTTGTCAATGCGACGAAAGAGAATCCTGCGAGTTTATCTTGTTAG
ATGGATGAATACTCACCCAAAAGACATGATATCGCACAGCTTAAGTTTCTCTGTGAAACCCTGTATCATGACTGCCTTGC
AAACCTTGAAGAAAGCAATCATGGCTGGGTTAACGACCCAACCTCGGCGATCAACCTCCAGTTGAATGAACTGATTGAGC
ATATTGCGACCTTCGCACTTAATTACAAAATTAAGTATAATGAAGACAATAAGCTCATTGAGCAGATCGACGAATATCTG
GATGACACCTTTATGTTGTTCAGTAGTTATGGTATTAATATGCAGGATCTTCAGAAATGGCGGAAGTCAGGTAATCGACT
ATTCCGTTGTTTTGTCAATGCGACGAAAGAGAATCCTGCGAGTTTATCTTGTTAG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|