Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yoeB-relB/YoeB-YefM |
Location | 566307..566809 | Replicon | chromosome |
Accession | NZ_CP043575 | ||
Organism | Comamonas koreensis strain T50-37 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | Q5XQD8 |
Locus tag | F0Q04_RS02645 | Protein ID | WP_032492620.1 |
Coordinates | 566307..566561 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1V0BEH6 |
Locus tag | F0Q04_RS02650 | Protein ID | WP_032492621.1 |
Coordinates | 566558..566809 (-) | Length | 84 a.a. |
Genomic Context
Location: 561318..561653 (336 bp)
Type: Others
Protein ID: WP_182344325.1
Type: Others
Protein ID: WP_182344325.1
Location: 561680..562642 (963 bp)
Type: Others
Protein ID: WP_182344327.1
Type: Others
Protein ID: WP_182344327.1
Location: 562663..562959 (297 bp)
Type: Others
Protein ID: WP_182283343.1
Type: Others
Protein ID: WP_182283343.1
Location: 563032..563313 (282 bp)
Type: Others
Protein ID: WP_182283342.1
Type: Others
Protein ID: WP_182283342.1
Location: 563335..563508 (174 bp)
Type: Others
Protein ID: WP_182283341.1
Type: Others
Protein ID: WP_182283341.1
Location: 563965..564669 (705 bp)
Type: Others
Protein ID: WP_001067855.1
Type: Others
Protein ID: WP_001067855.1
Location: 565680..566234 (555 bp)
Type: Others
Protein ID: WP_003159191.1
Type: Others
Protein ID: WP_003159191.1
Location: 566983..567537 (555 bp)
Type: Others
Protein ID: WP_014454105.1
Type: Others
Protein ID: WP_014454105.1
Location: 567642..568894 (1253 bp)
Type: Others
Protein ID: Protein_519
Type: Others
Protein ID: Protein_519
Location: 568992..569819 (828 bp)
Type: Others
Protein ID: WP_014386432.1
Type: Others
Protein ID: WP_014386432.1
Location: 569867..570340 (474 bp)
Type: Others
Protein ID: WP_071846295.1
Type: Others
Protein ID: WP_071846295.1
Location: 570532..570879 (348 bp)
Type: Others
Protein ID: WP_000679427.1
Type: Others
Protein ID: WP_000679427.1
Location: 564722..565519 (798 bp)
Type: Others
Protein ID: Protein_514
Type: Others
Protein ID: Protein_514
Location: 566307..566561 (255 bp)
Type: Toxin
Protein ID: WP_032492620.1
Type: Toxin
Protein ID: WP_032492620.1
Location: 566558..566809 (252 bp)
Type: Antitoxin
Protein ID: WP_032492621.1
Type: Antitoxin
Protein ID: WP_032492621.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F0Q04_RS02605 | 561318..561653 | + | 336 | WP_182344325.1 | hypothetical protein | - |
F0Q04_RS02610 | 561680..562642 | + | 963 | WP_182344327.1 | hypothetical protein | - |
F0Q04_RS02615 | 562663..562959 | + | 297 | WP_182283343.1 | H-NS histone family protein | - |
F0Q04_RS02620 | 563032..563313 | + | 282 | WP_182283342.1 | hypothetical protein | - |
F0Q04_RS02625 | 563335..563508 | + | 174 | WP_182283341.1 | hypothetical protein | - |
F0Q04_RS02630 | 563965..564669 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
F0Q04_RS02635 | 564722..565519 | - | 798 | Protein_514 | class 1 integron integrase IntI1 | - |
F0Q04_RS02640 | 565680..566234 | + | 555 | WP_003159191.1 | aminoglycoside N-acetyltransferase AAC(6')-Ib4 | - |
F0Q04_RS02645 | 566307..566561 | - | 255 | WP_032492620.1 | Txe/YoeB family addiction module toxin | Toxin |
F0Q04_RS02650 | 566558..566809 | - | 252 | WP_032492621.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
F0Q04_RS02655 | 566983..567537 | + | 555 | WP_014454105.1 | aminoglycoside N-acetyltransferase AAC(6')-Ib' | - |
F0Q04_RS02660 | 567642..568894 | + | 1253 | Protein_519 | EreA family erythromycin esterase | - |
F0Q04_RS02665 | 568992..569819 | + | 828 | WP_014386432.1 | OXA-2 family oxacillin-hydrolyzing class D beta-lactamase OXA-21 | - |
F0Q04_RS02670 | 569867..570340 | + | 474 | WP_071846295.1 | trimethoprim-resistant dihydrofolate reductase DfrA1 | - |
F0Q04_RS02675 | 570532..570879 | + | 348 | WP_000679427.1 | quaternary ammonium compound efflux SMR transporter QacE delta 1 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | aac(6')-Ib / ere(A) / blaOXA-21 / floR / aph(3'')-Ib / aph(6)-Id / tet(G) / sul1 / aph(3')-Ib / ant(3'')-Ia | - | 561006..604101 | 43095 | |
- | inside | IScluster/Tn | aac(6')-Ib / ere(A) / blaOXA-21 / floR / aph(3'')-Ib / aph(6)-Id / tet(G) / sul1 / aph(3')-Ib / ant(3'')-Ia | - | 559420..601734 | 42314 | |
- | inside | Integron | - | - | 564560..568894 | 4334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10272.81 Da Isoelectric Point: 9.3585
>T139044 WP_032492620.1 NZ_CP043575:c566561-566307 [Comamonas koreensis]
MRLIFSDDAWEDYLFWQKQDRRMVDRINKLIKETTREPFSGVGKPEPLKHALAGYWSRRITDEHRMVYKVADDALWIVQL
KYHY
MRLIFSDDAWEDYLFWQKQDRRMVDRINKLIKETTREPFSGVGKPEPLKHALAGYWSRRITDEHRMVYKVADDALWIVQL
KYHY
Download Length: 255 bp
>T139044 NZ_CP058342:2719322-2719429 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 84 a.a. Molecular weight: 9244.40 Da Isoelectric Point: 4.7769
>AT139044 WP_032492621.1 NZ_CP043575:c566809-566558 [Comamonas koreensis]
MDAITYTHARANLAGTMDRVCNDHEPVIITRNGDQSVVILSLEDFQALEETAYLLRSPANAKRLFKSIEQLEAGRGQARE
LAE
MDAITYTHARANLAGTMDRVCNDHEPVIITRNGDQSVVILSLEDFQALEETAYLLRSPANAKRLFKSIEQLEAGRGQARE
LAE
Download Length: 252 bp
>AT139044 NZ_CP058342:c2719275-2719209 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V0BEH9 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V0BEH6 |