Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1306179..1306871 | Replicon | chromosome |
Accession | NZ_CP043056 | ||
Organism | Dolichospermum sp. UHCC 0315A |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | BMF77_RS05965 | Protein ID | WP_148761411.1 |
Coordinates | 1306611..1306871 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | BMF77_RS05960 | Protein ID | WP_148761409.1 |
Coordinates | 1306179..1306517 (-) | Length | 113 a.a. |
Genomic Context
Location: 1301413..1302504 (1092 bp)
Type: Others
Protein ID: WP_148761401.1
Type: Others
Protein ID: WP_148761401.1
Location: 1302686..1303567 (882 bp)
Type: Others
Protein ID: WP_148761403.1
Type: Others
Protein ID: WP_148761403.1
Location: 1303967..1305073 (1107 bp)
Type: Others
Protein ID: WP_148761405.1
Type: Others
Protein ID: WP_148761405.1
Location: 1307574..1307825 (252 bp)
Type: Others
Protein ID: WP_148761413.1
Type: Others
Protein ID: WP_148761413.1
Location: 1307828..1307983 (156 bp)
Type: Others
Protein ID: WP_148761415.1
Type: Others
Protein ID: WP_148761415.1
Location: 1309238..1309453 (216 bp)
Type: Others
Protein ID: Protein_1182
Type: Others
Protein ID: Protein_1182
Location: 1309589..1309888 (300 bp)
Type: Others
Protein ID: WP_148761425.1
Type: Others
Protein ID: WP_148761425.1
Location: 1309885..1310085 (201 bp)
Type: Others
Protein ID: WP_148761427.1
Type: Others
Protein ID: WP_148761427.1
Location: 1310308..1310766 (459 bp)
Type: Others
Protein ID: WP_148761429.1
Type: Others
Protein ID: WP_148761429.1
Location: 1305469..1306062 (594 bp)
Type: Others
Protein ID: WP_148761407.1
Type: Others
Protein ID: WP_148761407.1
Location: 1306179..1306517 (339 bp)
Type: Antitoxin
Protein ID: WP_148761409.1
Type: Antitoxin
Protein ID: WP_148761409.1
Location: 1306611..1306871 (261 bp)
Type: Toxin
Protein ID: WP_148761411.1
Type: Toxin
Protein ID: WP_148761411.1
Location: 1307220..1307438 (219 bp)
Type: Others
Protein ID: WP_210422304.1
Type: Others
Protein ID: WP_210422304.1
Location: 1308025..1308336 (312 bp)
Type: Others
Protein ID: WP_148761417.1
Type: Others
Protein ID: WP_148761417.1
Location: 1308413..1308691 (279 bp)
Type: Others
Protein ID: WP_148761419.1
Type: Others
Protein ID: WP_148761419.1
Location: 1308966..1309178 (213 bp)
Type: Others
Protein ID: WP_148761421.1
Type: Others
Protein ID: WP_148761421.1
Location: 1310690..1311601 (912 bp)
Type: Others
Protein ID: WP_148761431.1
Type: Others
Protein ID: WP_148761431.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BMF77_RS05935 | 1301413..1302504 | + | 1092 | WP_148761401.1 | spermidine/putrescine ABC transporter substrate-binding protein | - |
BMF77_RS05940 | 1302686..1303567 | + | 882 | WP_148761403.1 | ABC transporter permease | - |
BMF77_RS05950 | 1303967..1305073 | + | 1107 | WP_148761405.1 | Gfo/Idh/MocA family oxidoreductase | - |
BMF77_RS05955 | 1305469..1306062 | - | 594 | WP_148761407.1 | hypothetical protein | - |
BMF77_RS05960 | 1306179..1306517 | - | 339 | WP_148761409.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BMF77_RS05965 | 1306611..1306871 | - | 261 | WP_148761411.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BMF77_RS05970 | 1307220..1307438 | - | 219 | WP_210422304.1 | cobaltochelatase subunit CobN | - |
BMF77_RS05975 | 1307574..1307825 | + | 252 | WP_148761413.1 | type II toxin-antitoxin system ParD family antitoxin | - |
BMF77_RS05980 | 1307828..1307983 | + | 156 | WP_148761415.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BMF77_RS05985 | 1308025..1308336 | - | 312 | WP_148761417.1 | HigA family addiction module antidote protein | - |
BMF77_RS05990 | 1308413..1308691 | - | 279 | WP_148761419.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BMF77_RS05995 | 1308966..1309178 | - | 213 | WP_148761421.1 | type II toxin-antitoxin system HicB family antitoxin | - |
BMF77_RS06005 | 1309238..1309453 | + | 216 | Protein_1182 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
BMF77_RS06010 | 1309589..1309888 | + | 300 | WP_148761425.1 | BrnT family toxin | - |
BMF77_RS06015 | 1309885..1310085 | + | 201 | WP_148761427.1 | hypothetical protein | - |
BMF77_RS06020 | 1310308..1310766 | + | 459 | WP_148761429.1 | DUF1848 family protein | - |
BMF77_RS06025 | 1310690..1311601 | - | 912 | WP_148761431.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 9643.00 Da Isoelectric Point: 8.6585
>T137028 WP_148761411.1 NZ_CP043056:c1306871-1306611 [Dolichospermum sp. UHCC 0315A]
MDLNNKQRKTLELIFTNPVPANIIWQDIESLFIALGAYISQGSGSRVGVKLNDVKGHFHEPHPHKETDKGTVKSVREFLT
KAGFEP
MDLNNKQRKTLELIFTNPVPANIIWQDIESLFIALGAYISQGSGSRVGVKLNDVKGHFHEPHPHKETDKGTVKSVREFLT
KAGFEP
Download Length: 261 bp
>T137028 NZ_CP043056:c1306871-1306611 [Dolichospermum sp. UHCC 0315A]
ATGGATCTCAACAATAAACAAAGAAAAACTTTAGAATTAATTTTTACAAATCCTGTACCAGCAAATATTATTTGGCAAGA
TATTGAAAGTCTATTTATAGCTTTAGGTGCTTATATTAGTCAAGGTAGCGGTTCAAGAGTAGGAGTTAAATTAAATGATG
TTAAAGGTCATTTTCATGAACCACATCCCCATAAAGAAACAGATAAAGGAACTGTTAAATCTGTACGTGAATTTTTGACA
AAAGCAGGATTTGAACCATAA
ATGGATCTCAACAATAAACAAAGAAAAACTTTAGAATTAATTTTTACAAATCCTGTACCAGCAAATATTATTTGGCAAGA
TATTGAAAGTCTATTTATAGCTTTAGGTGCTTATATTAGTCAAGGTAGCGGTTCAAGAGTAGGAGTTAAATTAAATGATG
TTAAAGGTCATTTTCATGAACCACATCCCCATAAAGAAACAGATAAAGGAACTGTTAAATCTGTACGTGAATTTTTGACA
AAAGCAGGATTTGAACCATAA
Antitoxin
Download Length: 113 a.a. Molecular weight: 12543.41 Da Isoelectric Point: 5.7723
>AT137028 WP_148761409.1 NZ_CP043056:c1306517-1306179 [Dolichospermum sp. UHCC 0315A]
MLTYKGYTASIEVDVEAGILFGRVLDINDVVTFKAKTVEEARQEFETSIDGYLAFCKELGEEPDKPFSGKLPFRTTPEHH
RKIFIAAKKAGKSINAWMDEMLINAAEKSVKA
MLTYKGYTASIEVDVEAGILFGRVLDINDVVTFKAKTVEEARQEFETSIDGYLAFCKELGEEPDKPFSGKLPFRTTPEHH
RKIFIAAKKAGKSINAWMDEMLINAAEKSVKA
Download Length: 339 bp
>AT137028 NZ_CP056421:c3109379-3109077 [Citrobacter sp. RHBSTW-00524]
ATGGGCAGAACGCTGGAACAGCTTATTGCGGATGAAAAACCTGAAGTCGTGGCCGAAGCTCAGGCGATGGCGACGGACAT
CCTGCTCAACATTCACCTTGCCGAACTGCGCGAGAAAGTGCAGAGAACGCAGGTCGAAATGGCGAAGGCGCTGGGGATCA
GGCAACCTACCGTTGCAGGAATGGAAAAACCGGGGCGCGACCTGAAGCTTTCCACGCTGAAACGCTACGTTGAAGCGACC
GGCGGCAAGCTACGCCTTGATATTGAACTGCCGGATGGTTCTCACTACGGATTTGTACTATAA
ATGGGCAGAACGCTGGAACAGCTTATTGCGGATGAAAAACCTGAAGTCGTGGCCGAAGCTCAGGCGATGGCGACGGACAT
CCTGCTCAACATTCACCTTGCCGAACTGCGCGAGAAAGTGCAGAGAACGCAGGTCGAAATGGCGAAGGCGCTGGGGATCA
GGCAACCTACCGTTGCAGGAATGGAAAAACCGGGGCGCGACCTGAAGCTTTCCACGCTGAAACGCTACGTTGAAGCGACC
GGCGGCAAGCTACGCCTTGATATTGAACTGCCGGATGGTTCTCACTACGGATTTGTACTATAA