Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-UPF0150 |
Location | 1276690..1277096 | Replicon | chromosome |
Accession | NZ_CP043056 | ||
Organism | Dolichospermum sp. UHCC 0315A |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | BMF77_RS05825 | Protein ID | WP_148761365.1 |
Coordinates | 1276690..1276872 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | BMF77_RS05830 | Protein ID | WP_015078601.1 |
Coordinates | 1276869..1277096 (+) | Length | 76 a.a. |
Genomic Context
Location: 1272095..1272697 (603 bp)
Type: Others
Protein ID: WP_148761353.1
Type: Others
Protein ID: WP_148761353.1
Location: 1272755..1273570 (816 bp)
Type: Others
Protein ID: WP_148761355.1
Type: Others
Protein ID: WP_148761355.1
Location: 1276690..1276872 (183 bp)
Type: Toxin
Protein ID: WP_148761365.1
Type: Toxin
Protein ID: WP_148761365.1
Location: 1276869..1277096 (228 bp)
Type: Antitoxin
Protein ID: WP_015078601.1
Type: Antitoxin
Protein ID: WP_015078601.1
Location: 1277875..1278495 (621 bp)
Type: Others
Protein ID: WP_148761371.1
Type: Others
Protein ID: WP_148761371.1
Location: 1278533..1278967 (435 bp)
Type: Others
Protein ID: WP_015078603.1
Type: Others
Protein ID: WP_015078603.1
Location: 1279128..1281809 (2682 bp)
Type: Others
Protein ID: WP_148761373.1
Type: Others
Protein ID: WP_148761373.1
Location: 1273658..1274029 (372 bp)
Type: Others
Protein ID: WP_148761357.1
Type: Others
Protein ID: WP_148761357.1
Location: 1274026..1274256 (231 bp)
Type: Others
Protein ID: WP_148761359.1
Type: Others
Protein ID: WP_148761359.1
Location: 1274291..1274497 (207 bp)
Type: Others
Protein ID: WP_148761361.1
Type: Others
Protein ID: WP_148761361.1
Location: 1275204..1276433 (1230 bp)
Type: Others
Protein ID: WP_148761363.1
Type: Others
Protein ID: WP_148761363.1
Location: 1277159..1277551 (393 bp)
Type: Others
Protein ID: WP_148761368.1
Type: Others
Protein ID: WP_148761368.1
Location: 1277552..1277800 (249 bp)
Type: Others
Protein ID: WP_148761369.1
Type: Others
Protein ID: WP_148761369.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BMF77_RS05790 | 1272095..1272697 | + | 603 | WP_148761353.1 | cell division protein SepF | - |
BMF77_RS05795 | 1272755..1273570 | + | 816 | WP_148761355.1 | pyrroline-5-carboxylate reductase | - |
BMF77_RS05800 | 1273658..1274029 | - | 372 | WP_148761357.1 | DUF5615 family PIN-like protein | - |
BMF77_RS05805 | 1274026..1274256 | - | 231 | WP_148761359.1 | DUF433 domain-containing protein | - |
BMF77_RS05810 | 1274291..1274497 | - | 207 | WP_148761361.1 | DUF2281 domain-containing protein | - |
BMF77_RS05820 | 1275204..1276433 | - | 1230 | WP_148761363.1 | GTPase domain-containing protein | - |
BMF77_RS05825 | 1276690..1276872 | + | 183 | WP_148761365.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BMF77_RS05830 | 1276869..1277096 | + | 228 | WP_015078601.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BMF77_RS05835 | 1277159..1277551 | - | 393 | WP_148761368.1 | type II toxin-antitoxin system VapC family toxin | - |
BMF77_RS05840 | 1277552..1277800 | - | 249 | WP_148761369.1 | DUF2281 domain-containing protein | - |
BMF77_RS05845 | 1277875..1278495 | + | 621 | WP_148761371.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
BMF77_RS05850 | 1278533..1278967 | + | 435 | WP_015078603.1 | DUF29 domain-containing protein | - |
BMF77_RS05855 | 1279128..1281809 | + | 2682 | WP_148761373.1 | RNA helicase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6710.89 Da Isoelectric Point: 10.6223
>T137027 WP_148761365.1 NZ_CP043056:1276690-1276872 [Dolichospermum sp. UHCC 0315A]
MKVKEVLKILEADGWYIDRTRGSHRILKHQSKSGIVVVPGKPSDDIPVGTLSSIWKQAKL
MKVKEVLKILEADGWYIDRTRGSHRILKHQSKSGIVVVPGKPSDDIPVGTLSSIWKQAKL
Download Length: 183 bp
>T137027 NZ_CP043056:1276690-1276872 [Dolichospermum sp. UHCC 0315A]
ATGAAGGTTAAAGAAGTTCTCAAAATCCTGGAAGCAGATGGTTGGTATATAGATCGCACCAGAGGTAGTCATCGTATCCT
CAAACATCAAAGCAAATCAGGTATCGTAGTTGTACCTGGAAAACCAAGTGATGATATTCCAGTAGGTACACTCTCATCAA
TTTGGAAGCAAGCAAAATTATGA
ATGAAGGTTAAAGAAGTTCTCAAAATCCTGGAAGCAGATGGTTGGTATATAGATCGCACCAGAGGTAGTCATCGTATCCT
CAAACATCAAAGCAAATCAGGTATCGTAGTTGTACCTGGAAAACCAAGTGATGATATTCCAGTAGGTACACTCTCATCAA
TTTGGAAGCAAGCAAAATTATGA
Antitoxin
Download Length: 76 a.a. Molecular weight: 8268.41 Da Isoelectric Point: 3.8954
>AT137027 WP_015078601.1 NZ_CP043056:1276869-1277096 [Dolichospermum sp. UHCC 0315A]
MNEKMIEYTVIYERGQTNWGAYVPDLPGCVSIGDTLAEVQENIKEAIALYLEVLKEDGQPIPEPSTEVGKVAVTI
MNEKMIEYTVIYERGQTNWGAYVPDLPGCVSIGDTLAEVQENIKEAIALYLEVLKEDGQPIPEPSTEVGKVAVTI
Download Length: 228 bp
>AT137027 NZ_CP043056:1276869-1277096 [Dolichospermum sp. UHCC 0315A]
ATGAACGAAAAAATGATTGAGTACACAGTCATCTACGAACGTGGACAGACAAACTGGGGTGCTTATGTTCCCGACTTACC
TGGTTGTGTCAGTATTGGCGATACTTTAGCAGAAGTACAGGAAAATATTAAAGAAGCGATCGCATTATACCTAGAAGTAT
TGAAAGAAGATGGACAACCCATACCCGAACCATCAACAGAAGTTGGTAAAGTTGCAGTGACAATATAA
ATGAACGAAAAAATGATTGAGTACACAGTCATCTACGAACGTGGACAGACAAACTGGGGTGCTTATGTTCCCGACTTACC
TGGTTGTGTCAGTATTGGCGATACTTTAGCAGAAGTACAGGAAAATATTAAAGAAGCGATCGCATTATACCTAGAAGTAT
TGAAAGAAGATGGACAACCCATACCCGAACCATCAACAGAAGTTGGTAAAGTTGCAGTGACAATATAA