Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 3164450..3164921 | Replicon | chromosome |
Accession | NZ_CP042326 | ||
Organism | Euhalothece natronophila Z-M001 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | FRE64_RS15585 | Protein ID | WP_146297072.1 |
Coordinates | 3164450..3164710 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | FRE64_RS15590 | Protein ID | WP_146297073.1 |
Coordinates | 3164700..3164921 (+) | Length | 74 a.a. |
Genomic Context
Location: 3160589..3161218 (630 bp)
Type: Others
Protein ID: WP_146297066.1
Type: Others
Protein ID: WP_146297066.1
Location: 3161255..3161719 (465 bp)
Type: Others
Protein ID: WP_146297067.1
Type: Others
Protein ID: WP_146297067.1
Location: 3162771..3163862 (1092 bp)
Type: Others
Protein ID: WP_146297070.1
Type: Others
Protein ID: WP_146297070.1
Location: 3164182..3164394 (213 bp)
Type: Others
Protein ID: WP_146297071.1
Type: Others
Protein ID: WP_146297071.1
Location: 3164450..3164710 (261 bp)
Type: Toxin
Protein ID: WP_146297072.1
Type: Toxin
Protein ID: WP_146297072.1
Location: 3164700..3164921 (222 bp)
Type: Antitoxin
Protein ID: WP_146297073.1
Type: Antitoxin
Protein ID: WP_146297073.1
Location: 3165086..3166177 (1092 bp)
Type: Others
Protein ID: WP_146297074.1
Type: Others
Protein ID: WP_146297074.1
Location: 3159631..3160098 (468 bp)
Type: Others
Protein ID: WP_146297064.1
Type: Others
Protein ID: WP_146297064.1
Location: 3160195..3160446 (252 bp)
Type: Others
Protein ID: WP_146297065.1
Type: Others
Protein ID: WP_146297065.1
Location: 3161870..3162490 (621 bp)
Type: Others
Protein ID: WP_146297068.1
Type: Others
Protein ID: WP_146297068.1
Location: 3162515..3162751 (237 bp)
Type: Others
Protein ID: WP_146297069.1
Type: Others
Protein ID: WP_146297069.1
Location: 3166258..3166704 (447 bp)
Type: Others
Protein ID: WP_146297395.1
Type: Others
Protein ID: WP_146297395.1
Location: 3166707..3166943 (237 bp)
Type: Others
Protein ID: WP_146297075.1
Type: Others
Protein ID: WP_146297075.1
Location: 3167704..3168057 (354 bp)
Type: Others
Protein ID: WP_186708878.1
Type: Others
Protein ID: WP_186708878.1
Location: 3168143..3168515 (373 bp)
Type: Others
Protein ID: Protein_3081
Type: Others
Protein ID: Protein_3081
Location: 3168512..3168751 (240 bp)
Type: Others
Protein ID: WP_146297077.1
Type: Others
Protein ID: WP_146297077.1
Location: 3168846..3169181 (336 bp)
Type: Others
Protein ID: WP_146297078.1
Type: Others
Protein ID: WP_146297078.1
Location: 3169178..3169480 (303 bp)
Type: Others
Protein ID: WP_146297397.1
Type: Others
Protein ID: WP_146297397.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FRE64_RS15545 | 3159631..3160098 | - | 468 | WP_146297064.1 | Hsp20/alpha crystallin family protein | - |
FRE64_RS15550 | 3160195..3160446 | - | 252 | WP_146297065.1 | hypothetical protein | - |
FRE64_RS15555 | 3160589..3161218 | + | 630 | WP_146297066.1 | phosphoribosylglycinamide formyltransferase | - |
FRE64_RS15560 | 3161255..3161719 | + | 465 | WP_146297067.1 | NADAR family protein | - |
FRE64_RS15565 | 3161870..3162490 | - | 621 | WP_146297068.1 | cyanoexosortase A system-associated protein | - |
FRE64_RS15570 | 3162515..3162751 | - | 237 | WP_146297069.1 | hypothetical protein | - |
FRE64_RS15575 | 3162771..3163862 | + | 1092 | WP_146297070.1 | ISAs1 family transposase | - |
FRE64_RS15580 | 3164182..3164394 | + | 213 | WP_146297071.1 | hypothetical protein | - |
FRE64_RS15585 | 3164450..3164710 | + | 261 | WP_146297072.1 | BrnT family toxin | Toxin |
FRE64_RS15590 | 3164700..3164921 | + | 222 | WP_146297073.1 | CopG family transcriptional regulator | Antitoxin |
FRE64_RS15595 | 3165086..3166177 | + | 1092 | WP_146297074.1 | ISAs1 family transposase | - |
FRE64_RS15600 | 3166258..3166704 | - | 447 | WP_146297395.1 | hypothetical protein | - |
FRE64_RS15605 | 3166707..3166943 | - | 237 | WP_146297075.1 | hypothetical protein | - |
FRE64_RS15610 | 3167704..3168057 | - | 354 | WP_186708878.1 | DUF559 domain-containing protein | - |
FRE64_RS15615 | 3168143..3168515 | - | 373 | Protein_3081 | type II toxin-antitoxin system VapC family toxin | - |
FRE64_RS15620 | 3168512..3168751 | - | 240 | WP_146297077.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
FRE64_RS15625 | 3168846..3169181 | - | 336 | WP_146297078.1 | DUF86 domain-containing protein | - |
FRE64_RS15630 | 3169178..3169480 | - | 303 | WP_146297397.1 | nucleotidyltransferase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10212.63 Da Isoelectric Point: 10.0937
>T135398 WP_146297072.1 NZ_CP042326:3164450-3164710 [Euhalothece natronophila Z-M001]
VKFTYDPAKSKSNQSKHGINFEQAQQLWLDPLRVEIEAQSTTEPRFMIIGKIEGKYWSAIVTYRHQTIRIISVRRSRQEE
IRVYES
VKFTYDPAKSKSNQSKHGINFEQAQQLWLDPLRVEIEAQSTTEPRFMIIGKIEGKYWSAIVTYRHQTIRIISVRRSRQEE
IRVYES
Download Length: 261 bp
>T135398 NZ_CP042326:3164450-3164710 [Euhalothece natronophila Z-M001]
GTGAAATTTACATATGATCCTGCGAAAAGTAAAAGTAATCAGTCTAAACATGGAATTAACTTTGAACAAGCGCAACAACT
TTGGTTAGATCCACTTCGGGTAGAAATTGAAGCCCAATCAACCACAGAGCCTCGATTTATGATTATTGGTAAAATTGAGG
GGAAATACTGGTCTGCAATTGTTACTTATCGTCATCAAACAATTCGCATCATTTCGGTAAGAAGATCGCGTCAAGAGGAG
ATAAGAGTATATGAATCCTGA
GTGAAATTTACATATGATCCTGCGAAAAGTAAAAGTAATCAGTCTAAACATGGAATTAACTTTGAACAAGCGCAACAACT
TTGGTTAGATCCACTTCGGGTAGAAATTGAAGCCCAATCAACCACAGAGCCTCGATTTATGATTATTGGTAAAATTGAGG
GGAAATACTGGTCTGCAATTGTTACTTATCGTCATCAAACAATTCGCATCATTTCGGTAAGAAGATCGCGTCAAGAGGAG
ATAAGAGTATATGAATCCTGA
Antitoxin
Download Length: 74 a.a. Molecular weight: 8549.82 Da Isoelectric Point: 4.6437
>AT135398 WP_146297073.1 NZ_CP042326:3164700-3164921 [Euhalothece natronophila Z-M001]
MNPEELDKKFDAGEDVMEFFDLSTLKRPELESKPINVNFPQWMIKGLDEEAKRLGVNREAVIKTWIAQKLDQK
MNPEELDKKFDAGEDVMEFFDLSTLKRPELESKPINVNFPQWMIKGLDEEAKRLGVNREAVIKTWIAQKLDQK
Download Length: 222 bp
>AT135398 NZ_CP042326:3164700-3164921 [Euhalothece natronophila Z-M001]
ATGAATCCTGAAGAATTAGATAAGAAATTTGATGCTGGTGAAGATGTAATGGAATTTTTTGATTTATCCACTCTTAAACG
CCCTGAGTTAGAGAGCAAGCCAATTAATGTTAACTTTCCGCAATGGATGATTAAAGGATTAGATGAAGAAGCAAAACGAT
TGGGAGTTAATCGAGAAGCCGTTATTAAAACTTGGATCGCGCAAAAACTAGATCAAAAATAG
ATGAATCCTGAAGAATTAGATAAGAAATTTGATGCTGGTGAAGATGTAATGGAATTTTTTGATTTATCCACTCTTAAACG
CCCTGAGTTAGAGAGCAAGCCAATTAATGTTAACTTTCCGCAATGGATGATTAAAGGATTAGATGAAGAAGCAAAACGAT
TGGGAGTTAATCGAGAAGCCGTTATTAAAACTTGGATCGCGCAAAAACTAGATCAAAAATAG