Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 2027173..2027620 Replicon chromosome
Accession NZ_CP038033
Organism Nitrosococcus wardiae strain D1FHS

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag E3U44_RS09820 Protein ID WP_134359758.1
Coordinates 2027462..2027620 (-) Length 53 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag E3U44_RS09815 Protein ID WP_206054978.1
Coordinates 2027173..2027322 (-) Length 50 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E3U44_RS19620 2022440..2022958 - 519 WP_206054748.1 PQQ-dependent sugar dehydrogenase -
E3U44_RS09770 2023144..2023344 + 201 WP_134357956.1 hypothetical protein -
E3U44_RS09775 2023437..2024642 + 1206 WP_134357957.1 glutathione-dependent formaldehyde dehydrogenase -
E3U44_RS09780 2024678..2024938 - 261 WP_134359756.1 BrnT family toxin -
E3U44_RS09785 2024992..2025270 + 279 WP_134357958.1 BrnA antitoxin family protein -
E3U44_RS09790 2025527..2025886 + 360 WP_206054750.1 hypothetical protein -
E3U44_RS09795 2025886..2026134 + 249 WP_134357959.1 hypothetical protein -
E3U44_RS09800 2026275..2026523 - 249 WP_134357960.1 DUF2442 domain-containing protein -
E3U44_RS09805 2026531..2026779 - 249 WP_134357961.1 DUF4160 domain-containing protein -
E3U44_RS09810 2026831..2027109 - 279 WP_134357962.1 HigA family addiction module antidote protein -
E3U44_RS09815 2027173..2027322 - 150 WP_206054978.1 CopG family transcriptional regulator Antitoxin
E3U44_RS09820 2027462..2027620 - 159 WP_134359758.1 BrnT family toxin Toxin
E3U44_RS09825 2027647..2027829 + 183 WP_134357964.1 hypothetical protein -
E3U44_RS09830 2027867..2028160 - 294 WP_206054979.1 helix-turn-helix domain-containing protein -
E3U44_RS09835 2028164..2028457 - 294 Protein_1944 transcriptional regulator -
E3U44_RS09840 2028598..2028822 + 225 WP_013033471.1 TraY domain-containing protein -
E3U44_RS09845 2028806..2029078 + 273 WP_134357965.1 type II toxin-antitoxin system RelE/ParE family toxin -
E3U44_RS09850 2029233..2029454 - 222 WP_134357966.1 pilus assembly protein HicB -
E3U44_RS09855 2029451..2029654 - 204 WP_134357967.1 type II toxin-antitoxin system HicA family toxin -
E3U44_RS09860 2029704..2029787 - 84 WP_134359762.1 hypothetical protein -
E3U44_RS09865 2029824..2030111 - 288 WP_134357968.1 helix-turn-helix domain-containing protein -
E3U44_RS09870 2030967..2031227 - 261 WP_134357969.1 helix-turn-helix domain-containing protein -
E3U44_RS09875 2031229..2031510 - 282 WP_134357970.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
E3U44_RS09880 2031477..2032349 - 873 WP_134357971.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(5-44)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 53 a.a.        Molecular weight: 5992.07 Da        Isoelectric Point: 11.1416

>T120684 WP_134359758.1 NZ_CP038033:c2027620-2027462 [Nitrosococcus wardiae]
IPATTVDEPRFLVIGRIKDKHWSAVITHRSEKIRIISVRRSLSEEVISIPIK

Download         Length: 159 bp

>T120684 NZ_CP038033:c2027620-2027462 [Nitrosococcus wardiae]
ATCCCGGCCACAACGGTGGATGAACCAAGATTTTTGGTTATTGGCCGTATTAAGGATAAGCATTGGTCAGCGGTGATCAC
ACACAGGAGCGAAAAAATCCGCATCATCTCTGTCCGTCGTTCCCTGTCCGAAGAGGTAATATCAATCCCAATAAAATAG

Antitoxin


Download         Length: 50 a.a.        Molecular weight: 5778.76 Da        Isoelectric Point: 10.9761

>AT120684 WP_206054978.1 NZ_CP038033:c2027322-2027173 [Nitrosococcus wardiae]
MTHALDISKARRPLQKQRRVNVDFPDWMIESLDREACRLGVTRQSIIKV

Download         Length: 150 bp

>AT120684 NZ_CP038033:c2027322-2027173 [Nitrosococcus wardiae]
ATGACTCATGCCTTGGATATTTCCAAGGCGCGTCGTCCACTTCAAAAGCAAAGGCGTGTCAATGTGGATTTTCCAGACTG
GATGATTGAATCCCTCGACAGGGAAGCTTGCCGGCTGGGAGTGACGCGCCAGTCGATCATCAAAGTTTAG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References