Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 1266522..1267152 | Replicon | chromosome |
Accession | NZ_CP034363 | ||
Organism | Pantoea sp. CCBC3-3-1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | EHV07_RS05875 | Protein ID | WP_147195990.1 |
Coordinates | 1266522..1266698 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EHV07_RS05880 | Protein ID | WP_147195992.1 |
Coordinates | 1266745..1267152 (+) | Length | 136 a.a. |
Genomic Context
Location: 1261677..1261955 (279 bp)
Type: Others
Protein ID: WP_147195963.1
Type: Others
Protein ID: WP_147195963.1
Location: 1261952..1262131 (180 bp)
Type: Others
Protein ID: WP_147195965.1
Type: Others
Protein ID: WP_147195965.1
Location: 1262135..1262581 (447 bp)
Type: Others
Protein ID: WP_147195969.1
Type: Others
Protein ID: WP_147195969.1
Location: 1262581..1262955 (375 bp)
Type: Others
Protein ID: WP_147200539.1
Type: Others
Protein ID: WP_147200539.1
Location: 1262964..1263551 (588 bp)
Type: Others
Protein ID: WP_147195973.1
Type: Others
Protein ID: WP_147195973.1
Location: 1263548..1263835 (288 bp)
Type: Others
Protein ID: WP_147195975.1
Type: Others
Protein ID: WP_147195975.1
Location: 1263819..1263989 (171 bp)
Type: Others
Protein ID: WP_147195978.1
Type: Others
Protein ID: WP_147195978.1
Location: 1263986..1264183 (198 bp)
Type: Others
Protein ID: WP_168199597.1
Type: Others
Protein ID: WP_168199597.1
Location: 1264378..1264953 (576 bp)
Type: Others
Protein ID: WP_147195982.1
Type: Others
Protein ID: WP_147195982.1
Location: 1265123..1265737 (615 bp)
Type: Others
Protein ID: WP_147195984.1
Type: Others
Protein ID: WP_147195984.1
Location: 1266522..1266698 (177 bp)
Type: Toxin
Protein ID: WP_147195990.1
Type: Toxin
Protein ID: WP_147195990.1
Location: 1266745..1267152 (408 bp)
Type: Antitoxin
Protein ID: WP_147195992.1
Type: Antitoxin
Protein ID: WP_147195992.1
Location: 1267381..1267731 (351 bp)
Type: Others
Protein ID: WP_147200540.1
Type: Others
Protein ID: WP_147200540.1
Location: 1267718..1268155 (438 bp)
Type: Others
Protein ID: WP_147195994.1
Type: Others
Protein ID: WP_147195994.1
Location: 1268444..1268740 (297 bp)
Type: Others
Protein ID: WP_168199598.1
Type: Others
Protein ID: WP_168199598.1
Location: 1268744..1268980 (237 bp)
Type: Others
Protein ID: WP_147196001.1
Type: Others
Protein ID: WP_147196001.1
Location: 1269255..1270142 (888 bp)
Type: Others
Protein ID: WP_147196003.1
Type: Others
Protein ID: WP_147196003.1
Location: 1270150..1270401 (252 bp)
Type: Others
Protein ID: WP_147196005.1
Type: Others
Protein ID: WP_147196005.1
Location: 1270391..1270771 (381 bp)
Type: Others
Protein ID: WP_147196007.1
Type: Others
Protein ID: WP_147196007.1
Location: 1271366..1271938 (573 bp)
Type: Others
Protein ID: WP_147196011.1
Type: Others
Protein ID: WP_147196011.1
Location: 1266030..1266236 (207 bp)
Type: Others
Protein ID: WP_147195988.1
Type: Others
Protein ID: WP_147195988.1
Location: 1270899..1271345 (447 bp)
Type: Others
Protein ID: WP_147196009.1
Type: Others
Protein ID: WP_147196009.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EHV07_RS05815 | 1261677..1261955 | + | 279 | WP_147195963.1 | hypothetical protein | - |
EHV07_RS05820 | 1261952..1262131 | + | 180 | WP_147195965.1 | hypothetical protein | - |
EHV07_RS05825 | 1262135..1262581 | + | 447 | WP_147195969.1 | hypothetical protein | - |
EHV07_RS05830 | 1262581..1262955 | + | 375 | WP_147200539.1 | ASCH domain-containing protein | - |
EHV07_RS05835 | 1262964..1263551 | + | 588 | WP_147195973.1 | S-adenosylmethionine-binding protein | - |
EHV07_RS05840 | 1263548..1263835 | + | 288 | WP_147195975.1 | hypothetical protein | - |
EHV07_RS05845 | 1263819..1263989 | + | 171 | WP_147195978.1 | NinE family protein | - |
EHV07_RS05850 | 1263986..1264183 | + | 198 | WP_168199597.1 | hypothetical protein | - |
EHV07_RS05855 | 1264378..1264953 | + | 576 | WP_147195982.1 | recombination protein NinG | - |
EHV07_RS05860 | 1265123..1265737 | + | 615 | WP_147195984.1 | hypothetical protein | - |
EHV07_RS05870 | 1266030..1266236 | - | 207 | WP_147195988.1 | hypothetical protein | - |
EHV07_RS05875 | 1266522..1266698 | + | 177 | WP_147195990.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EHV07_RS05880 | 1266745..1267152 | + | 408 | WP_147195992.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EHV07_RS05885 | 1267381..1267731 | + | 351 | WP_147200540.1 | phage holin, lambda family | - |
EHV07_RS05890 | 1267718..1268155 | + | 438 | WP_147195994.1 | lysozyme | - |
EHV07_RS05900 | 1268444..1268740 | + | 297 | WP_168199598.1 | peptidase | - |
EHV07_RS05905 | 1268744..1268980 | + | 237 | WP_147196001.1 | hypothetical protein | - |
EHV07_RS05915 | 1269255..1270142 | + | 888 | WP_147196003.1 | hypothetical protein | - |
EHV07_RS05920 | 1270150..1270401 | + | 252 | WP_147196005.1 | hypothetical protein | - |
EHV07_RS05925 | 1270391..1270771 | + | 381 | WP_147196007.1 | hypothetical protein | - |
EHV07_RS05930 | 1270899..1271345 | - | 447 | WP_147196009.1 | hypothetical protein | - |
EHV07_RS05935 | 1271366..1271938 | + | 573 | WP_147196011.1 | terminase small subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | acrB / acrA | 1179950..1310593 | 130643 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6709.87 Da Isoelectric Point: 10.8214
>T115785 WP_147195990.1 NZ_CP034363:1266522-1266698 [Pantoea sp. CCBC3-3-1]
VKQSEFQRWLAAQGAEFKNGTNHLKIYLNDKQTIMPRHPGKEIPEPLRKAILKQLGLK
VKQSEFQRWLAAQGAEFKNGTNHLKIYLNDKQTIMPRHPGKEIPEPLRKAILKQLGLK
Download Length: 177 bp
>T115785 NZ_CP034363:1266522-1266698 [Pantoea sp. CCBC3-3-1]
GTGAAGCAAAGCGAGTTTCAACGTTGGCTTGCAGCGCAAGGGGCAGAATTTAAGAACGGCACAAACCACCTTAAAATCTA
CCTGAACGACAAGCAGACGATAATGCCGAGGCATCCGGGGAAGGAAATACCGGAGCCGCTGAGAAAAGCGATTCTCAAGC
AACTCGGTCTTAAATAA
GTGAAGCAAAGCGAGTTTCAACGTTGGCTTGCAGCGCAAGGGGCAGAATTTAAGAACGGCACAAACCACCTTAAAATCTA
CCTGAACGACAAGCAGACGATAATGCCGAGGCATCCGGGGAAGGAAATACCGGAGCCGCTGAGAAAAGCGATTCTCAAGC
AACTCGGTCTTAAATAA
Antitoxin
Download Length: 136 a.a. Molecular weight: 14631.65 Da Isoelectric Point: 4.2606
>AT115785 WP_147195992.1 NZ_CP034363:1266745-1267152 [Pantoea sp. CCBC3-3-1]
MRYPVTLDCDDTGCAVLFPDIPEAVTGGDTREEALAMAQDALVTAFDFYFEDRREVPPPSSEGEAFVEVPASVAAKVLLL
NAVVQAGVTNAELARMIDTRPQEITRVFDLHHSTKIDTIQKALSALGKRLELAAV
MRYPVTLDCDDTGCAVLFPDIPEAVTGGDTREEALAMAQDALVTAFDFYFEDRREVPPPSSEGEAFVEVPASVAAKVLLL
NAVVQAGVTNAELARMIDTRPQEITRVFDLHHSTKIDTIQKALSALGKRLELAAV
Download Length: 408 bp
>AT115785 NZ_CP034363:1266745-1267152 [Pantoea sp. CCBC3-3-1]
ATGAGATACCCAGTAACATTAGATTGTGACGATACGGGATGCGCAGTGCTGTTTCCTGACATCCCGGAAGCGGTGACGGG
CGGCGATACCAGAGAAGAGGCGTTAGCAATGGCGCAAGACGCTCTGGTAACTGCATTTGATTTCTATTTTGAAGATCGTC
GTGAAGTGCCGCCGCCATCGTCAGAGGGTGAGGCTTTTGTAGAAGTGCCGGCAAGCGTAGCTGCCAAGGTGCTTTTGCTC
AATGCCGTGGTTCAGGCTGGCGTAACCAACGCCGAGCTGGCCCGCATGATAGATACGCGCCCGCAAGAGATTACACGGGT
GTTTGATCTGCATCACTCGACCAAAATCGACACTATCCAGAAGGCGCTATCGGCGCTGGGCAAGCGGCTGGAACTGGCCG
CTGTCTAA
ATGAGATACCCAGTAACATTAGATTGTGACGATACGGGATGCGCAGTGCTGTTTCCTGACATCCCGGAAGCGGTGACGGG
CGGCGATACCAGAGAAGAGGCGTTAGCAATGGCGCAAGACGCTCTGGTAACTGCATTTGATTTCTATTTTGAAGATCGTC
GTGAAGTGCCGCCGCCATCGTCAGAGGGTGAGGCTTTTGTAGAAGTGCCGGCAAGCGTAGCTGCCAAGGTGCTTTTGCTC
AATGCCGTGGTTCAGGCTGGCGTAACCAACGCCGAGCTGGCCCGCATGATAGATACGCGCCCGCAAGAGATTACACGGGT
GTTTGATCTGCATCACTCGACCAAAATCGACACTATCCAGAAGGCGCTATCGGCGCTGGGCAAGCGGCTGGAACTGGCCG
CTGTCTAA