Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1059168..1059727 | Replicon | chromosome |
Accession | NZ_CP033144 | ||
Organism | Vibrio owensii strain V180403 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | D0856_RS05400 | Protein ID | WP_122067420.1 |
Coordinates | 1059168..1059446 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A347UR21 |
Locus tag | D0856_RS05405 | Protein ID | WP_005398409.1 |
Coordinates | 1059443..1059727 (-) | Length | 95 a.a. |
Genomic Context
Location: 1054468..1054557 (90 bp)
Type: Others
Protein ID: WP_072039143.1
Type: Others
Protein ID: WP_072039143.1
Location: 1054998..1055087 (90 bp)
Type: Others
Protein ID: WP_206387585.1
Type: Others
Protein ID: WP_206387585.1
Location: 1055161..1055649 (489 bp)
Type: Others
Protein ID: WP_122068875.1
Type: Others
Protein ID: WP_122068875.1
Location: 1055675..1055767 (93 bp)
Type: Others
Protein ID: Protein_1015
Type: Others
Protein ID: Protein_1015
Location: 1055802..1056074 (273 bp)
Type: Others
Protein ID: WP_122067413.1
Type: Others
Protein ID: WP_122067413.1
Location: 1056166..1056258 (93 bp)
Type: Others
Protein ID: WP_206387564.1
Type: Others
Protein ID: WP_206387564.1
Location: 1056485..1056652 (168 bp)
Type: Others
Protein ID: WP_163000551.1
Type: Others
Protein ID: WP_163000551.1
Location: 1056823..1057293 (471 bp)
Type: Others
Protein ID: WP_122067416.1
Type: Others
Protein ID: WP_122067416.1
Location: 1057323..1057415 (93 bp)
Type: Others
Protein ID: WP_206387565.1
Type: Others
Protein ID: WP_206387565.1
Location: 1057452..1057829 (378 bp)
Type: Others
Protein ID: WP_122067418.1
Type: Others
Protein ID: WP_122067418.1
Location: 1057844..1057936 (93 bp)
Type: Others
Protein ID: WP_206387566.1
Type: Others
Protein ID: WP_206387566.1
Location: 1058361..1059005 (645 bp)
Type: Others
Protein ID: WP_017191304.1
Type: Others
Protein ID: WP_017191304.1
Location: 1059991..1060299 (309 bp)
Type: Others
Protein ID: WP_122067421.1
Type: Others
Protein ID: WP_122067421.1
Location: 1060337..1060426 (90 bp)
Type: Others
Protein ID: WP_071881309.1
Type: Others
Protein ID: WP_071881309.1
Location: 1060495..1060851 (357 bp)
Type: Others
Protein ID: WP_020198239.1
Type: Others
Protein ID: WP_020198239.1
Location: 1060885..1060976 (92 bp)
Type: Others
Protein ID: Protein_1029
Type: Others
Protein ID: Protein_1029
Location: 1061437..1061526 (90 bp)
Type: Others
Protein ID: WP_122068877.1
Type: Others
Protein ID: WP_122068877.1
Location: 1061639..1062529 (891 bp)
Type: Others
Protein ID: WP_163000572.1
Type: Others
Protein ID: WP_163000572.1
Location: 1062529..1063077 (549 bp)
Type: Others
Protein ID: WP_122067424.1
Type: Others
Protein ID: WP_122067424.1
Location: 1063102..1063194 (93 bp)
Type: Others
Protein ID: WP_122067425.1
Type: Others
Protein ID: WP_122067425.1
Location: 1063237..1063983 (747 bp)
Type: Others
Protein ID: WP_122067426.1
Type: Others
Protein ID: WP_122067426.1
Location: 1064005..1064097 (93 bp)
Type: Others
Protein ID: WP_079752431.1
Type: Others
Protein ID: WP_079752431.1
Location: 1059168..1059446 (279 bp)
Type: Toxin
Protein ID: WP_122067420.1
Type: Toxin
Protein ID: WP_122067420.1
Location: 1059443..1059727 (285 bp)
Type: Antitoxin
Protein ID: WP_005398409.1
Type: Antitoxin
Protein ID: WP_005398409.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D0856_RS05330 | 1054468..1054557 | + | 90 | WP_072039143.1 | DUF3265 domain-containing protein | - |
D0856_RS30765 | 1054998..1055087 | + | 90 | WP_206387585.1 | DUF3265 domain-containing protein | - |
D0856_RS05340 | 1055161..1055649 | + | 489 | WP_122068875.1 | hypothetical protein | - |
D0856_RS05345 | 1055675..1055767 | + | 93 | Protein_1015 | DUF3265 domain-containing protein | - |
D0856_RS05350 | 1055802..1056074 | + | 273 | WP_122067413.1 | hypothetical protein | - |
D0856_RS30770 | 1056166..1056258 | + | 93 | WP_206387564.1 | DUF3265 domain-containing protein | - |
D0856_RS30535 | 1056485..1056652 | + | 168 | WP_163000551.1 | hypothetical protein | - |
D0856_RS05365 | 1056823..1057293 | + | 471 | WP_122067416.1 | GNAT family N-acetyltransferase | - |
D0856_RS05370 | 1057323..1057415 | + | 93 | WP_206387565.1 | DUF3265 domain-containing protein | - |
D0856_RS05375 | 1057452..1057829 | + | 378 | WP_122067418.1 | hypothetical protein | - |
D0856_RS05380 | 1057844..1057936 | + | 93 | WP_206387566.1 | DUF3265 domain-containing protein | - |
D0856_RS05390 | 1058361..1059005 | + | 645 | WP_017191304.1 | hypothetical protein | - |
D0856_RS05400 | 1059168..1059446 | - | 279 | WP_122067420.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
D0856_RS05405 | 1059443..1059727 | - | 285 | WP_005398409.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
D0856_RS05410 | 1059991..1060299 | + | 309 | WP_122067421.1 | hypothetical protein | - |
D0856_RS05415 | 1060337..1060426 | + | 90 | WP_071881309.1 | DUF3265 domain-containing protein | - |
D0856_RS05420 | 1060495..1060851 | + | 357 | WP_020198239.1 | hypothetical protein | - |
D0856_RS05425 | 1060885..1060976 | + | 92 | Protein_1029 | DUF3265 domain-containing protein | - |
D0856_RS05435 | 1061437..1061526 | + | 90 | WP_122068877.1 | DUF3265 domain-containing protein | - |
D0856_RS05440 | 1061639..1062529 | + | 891 | WP_163000572.1 | DUF4747 family protein | - |
D0856_RS05445 | 1062529..1063077 | + | 549 | WP_122067424.1 | hypothetical protein | - |
D0856_RS05450 | 1063102..1063194 | + | 93 | WP_122067425.1 | DUF3265 domain-containing protein | - |
D0856_RS05455 | 1063237..1063983 | + | 747 | WP_122067426.1 | hypothetical protein | - |
D0856_RS05460 | 1064005..1064097 | + | 93 | WP_079752431.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1003789..1099087 | 95298 | |
- | inside | Integron | - | - | 1002589..1090257 | 87668 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10832.55 Da Isoelectric Point: 4.5332
>T113251 WP_122067420.1 NZ_CP033144:c1059446-1059168 [Vibrio owensii]
MILWEEESLNDREKIFEFLYGFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGNIIRVM
RVLHQKQKFPTD
MILWEEESLNDREKIFEFLYGFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGNIIRVM
RVLHQKQKFPTD
Download Length: 279 bp
>T113251 NZ_CP033144:c1059446-1059168 [Vibrio owensii]
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTCGAGTTTCTCTATGGCTTCAACCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAAAGTAGAAAACTTGCTTGAACAACCTTTAATGGGTGTACAACGAGATGGCA
TCCGCGGACGATTACTCATTATTCCTGAGATTTCGATGATTGTCTCTTACTGGGTCGAGGGCAATATTATCCGAGTTATG
CGTGTACTCCACCAGAAACAAAAATTCCCTACGGATTGA
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTCGAGTTTCTCTATGGCTTCAACCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAAAGTAGAAAACTTGCTTGAACAACCTTTAATGGGTGTACAACGAGATGGCA
TCCGCGGACGATTACTCATTATTCCTGAGATTTCGATGATTGTCTCTTACTGGGTCGAGGGCAATATTATCCGAGTTATG
CGTGTACTCCACCAGAAACAAAAATTCCCTACGGATTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 11069.40 Da Isoelectric Point: 9.2167
>AT113251 WP_005398409.1 NZ_CP033144:c1059727-1059443 [Vibrio owensii]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ
Download Length: 285 bp
>AT113251 NZ_CP033144:c1059727-1059443 [Vibrio owensii]
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGCAC
TCTAAGTGACGCATGCCGTGAACTTACTGAGCAACTCGCTGAACAACAAAGAAAAACATTGTCTCACGATGCATGGTTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCCGTTTTCGTTGAGCACCAAACTGCTAAATCTCGA
ATGGAAGAGCGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGCAC
TCTAAGTGACGCATGCCGTGAACTTACTGAGCAACTCGCTGAACAACAAAGAAAAACATTGTCTCACGATGCATGGTTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCCGTTTTCGTTGAGCACCAAACTGCTAAATCTCGA
ATGGAAGAGCGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR21 |