Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1049239..1049798 | Replicon | chromosome |
Accession | NZ_CP033144 | ||
Organism | Vibrio owensii strain V180403 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A347UR22 |
Locus tag | D0856_RS05265 | Protein ID | WP_005398411.1 |
Coordinates | 1049239..1049517 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A347UR21 |
Locus tag | D0856_RS05270 | Protein ID | WP_005398409.1 |
Coordinates | 1049514..1049798 (-) | Length | 95 a.a. |
Genomic Context
Location: 1044311..1045144 (834 bp)
Type: Others
Protein ID: WP_122067396.1
Type: Others
Protein ID: WP_122067396.1
Location: 1045276..1045971 (696 bp)
Type: Others
Protein ID: WP_122067397.1
Type: Others
Protein ID: WP_122067397.1
Location: 1046310..1046459 (150 bp)
Type: Others
Protein ID: WP_163000571.1
Type: Others
Protein ID: WP_163000571.1
Location: 1046628..1047188 (561 bp)
Type: Others
Protein ID: WP_049877106.1
Type: Others
Protein ID: WP_049877106.1
Location: 1047203..1047295 (93 bp)
Type: Others
Protein ID: WP_198039109.1
Type: Others
Protein ID: WP_198039109.1
Location: 1047331..1047708 (378 bp)
Type: Others
Protein ID: WP_122067398.1
Type: Others
Protein ID: WP_122067398.1
Location: 1047693..1047815 (123 bp)
Type: Others
Protein ID: WP_082314566.1
Type: Others
Protein ID: WP_082314566.1
Location: 1047909..1048265 (357 bp)
Type: Others
Protein ID: WP_122067399.1
Type: Others
Protein ID: WP_122067399.1
Location: 1048366..1048455 (90 bp)
Type: Others
Protein ID: WP_071881309.1
Type: Others
Protein ID: WP_071881309.1
Location: 1049119..1049210 (92 bp)
Type: Others
Protein ID: Protein_999
Type: Others
Protein ID: Protein_999
Location: 1049875..1049988 (114 bp)
Type: Others
Protein ID: WP_122067402.1
Type: Others
Protein ID: WP_122067402.1
Location: 1050649..1050741 (93 bp)
Type: Others
Protein ID: WP_122067403.1
Type: Others
Protein ID: WP_122067403.1
Location: 1050769..1051068 (300 bp)
Type: Others
Protein ID: WP_122067404.1
Type: Others
Protein ID: WP_122067404.1
Location: 1051065..1051187 (123 bp)
Type: Others
Protein ID: WP_122067405.1
Type: Others
Protein ID: WP_122067405.1
Location: 1051250..1051762 (513 bp)
Type: Others
Protein ID: WP_122067406.1
Type: Others
Protein ID: WP_122067406.1
Location: 1051781..1051873 (93 bp)
Type: Others
Protein ID: WP_122067407.1
Type: Others
Protein ID: WP_122067407.1
Location: 1051924..1053372 (1449 bp)
Type: Others
Protein ID: WP_206387563.1
Type: Others
Protein ID: WP_206387563.1
Location: 1053928..1054017 (90 bp)
Type: Others
Protein ID: WP_123768104.1
Type: Others
Protein ID: WP_123768104.1
Location: 1054050..1054445 (396 bp)
Type: Others
Protein ID: WP_122067411.1
Type: Others
Protein ID: WP_122067411.1
Location: 1054468..1054557 (90 bp)
Type: Others
Protein ID: WP_072039143.1
Type: Others
Protein ID: WP_072039143.1
Location: 1048484..1048753 (270 bp)
Type: Others
Protein ID: WP_122067401.1
Type: Others
Protein ID: WP_122067401.1
Location: 1048758..1049042 (285 bp)
Type: Others
Protein ID: WP_005398409.1
Type: Others
Protein ID: WP_005398409.1
Location: 1049239..1049517 (279 bp)
Type: Toxin
Protein ID: WP_005398411.1
Type: Toxin
Protein ID: WP_005398411.1
Location: 1049514..1049798 (285 bp)
Type: Antitoxin
Protein ID: WP_005398409.1
Type: Antitoxin
Protein ID: WP_005398409.1
Location: 1050032..1050526 (495 bp)
Type: Others
Protein ID: WP_023623381.1
Type: Others
Protein ID: WP_023623381.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D0856_RS05200 | 1044311..1045144 | + | 834 | WP_122067396.1 | EcsC family protein | - |
D0856_RS05210 | 1045276..1045971 | + | 696 | WP_122067397.1 | FRG domain-containing protein | - |
D0856_RS30530 | 1046310..1046459 | + | 150 | WP_163000571.1 | hypothetical protein | - |
D0856_RS05220 | 1046628..1047188 | + | 561 | WP_049877106.1 | YdcF family protein | - |
D0856_RS05225 | 1047203..1047295 | + | 93 | WP_198039109.1 | DUF3265 domain-containing protein | - |
D0856_RS05230 | 1047331..1047708 | + | 378 | WP_122067398.1 | hypothetical protein | - |
D0856_RS05235 | 1047693..1047815 | + | 123 | WP_082314566.1 | DUF3265 domain-containing protein | - |
D0856_RS05240 | 1047909..1048265 | + | 357 | WP_122067399.1 | hypothetical protein | - |
D0856_RS05245 | 1048366..1048455 | + | 90 | WP_071881309.1 | DUF3265 domain-containing protein | - |
D0856_RS05250 | 1048484..1048753 | - | 270 | WP_122067401.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
D0856_RS05255 | 1048758..1049042 | - | 285 | WP_005398409.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
D0856_RS05260 | 1049119..1049210 | + | 92 | Protein_999 | DUF3265 domain-containing protein | - |
D0856_RS05265 | 1049239..1049517 | - | 279 | WP_005398411.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
D0856_RS05270 | 1049514..1049798 | - | 285 | WP_005398409.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
D0856_RS05275 | 1049875..1049988 | + | 114 | WP_122067402.1 | DUF3265 domain-containing protein | - |
D0856_RS05280 | 1050032..1050526 | - | 495 | WP_023623381.1 | hypothetical protein | - |
D0856_RS05285 | 1050649..1050741 | + | 93 | WP_122067403.1 | DUF3265 domain-containing protein | - |
D0856_RS05290 | 1050769..1051068 | + | 300 | WP_122067404.1 | hypothetical protein | - |
D0856_RS05295 | 1051065..1051187 | + | 123 | WP_122067405.1 | DUF3265 domain-containing protein | - |
D0856_RS05300 | 1051250..1051762 | + | 513 | WP_122067406.1 | hypothetical protein | - |
D0856_RS05305 | 1051781..1051873 | + | 93 | WP_122067407.1 | DUF3265 domain-containing protein | - |
D0856_RS05310 | 1051924..1053372 | + | 1449 | WP_206387563.1 | caspase family protein | - |
D0856_RS05320 | 1053928..1054017 | + | 90 | WP_123768104.1 | DUF3265 domain-containing protein | - |
D0856_RS05325 | 1054050..1054445 | + | 396 | WP_122067411.1 | hypothetical protein | - |
D0856_RS05330 | 1054468..1054557 | + | 90 | WP_072039143.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1003789..1099087 | 95298 | |
- | inside | Integron | - | - | 1002589..1090257 | 87668 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10891.57 Da Isoelectric Point: 4.3430
>T113250 WP_005398411.1 NZ_CP033144:c1049517-1049239 [Vibrio owensii]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
Download Length: 279 bp
>T113250 NZ_CP033144:c1049517-1049239 [Vibrio owensii]
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTCGAGTTTCTCTATGACTTCAACCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAAAGTAGAAAACTTGCTTGAACAACCTTTGATGGGTGTACAACGAGATGGCA
TCCGCGGACGATTGCTCATTATTCCTGAGATTTCGATGATTGTCTCTTACTGGGTCGAGGGCGATATCATCAGAGTTATG
CGTGTACTCCACCAGAAACAAAAATTCCCTACGGATTGA
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTCGAGTTTCTCTATGACTTCAACCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAAAGTAGAAAACTTGCTTGAACAACCTTTGATGGGTGTACAACGAGATGGCA
TCCGCGGACGATTGCTCATTATTCCTGAGATTTCGATGATTGTCTCTTACTGGGTCGAGGGCGATATCATCAGAGTTATG
CGTGTACTCCACCAGAAACAAAAATTCCCTACGGATTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 11069.40 Da Isoelectric Point: 9.2167
>AT113250 WP_005398409.1 NZ_CP033144:c1049798-1049514 [Vibrio owensii]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ
Download Length: 285 bp
>AT113250 NZ_CP033144:c1049798-1049514 [Vibrio owensii]
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGAAC
TCTAAGTGATGCTTGCCGTGAACTTACTGAGCAACTCGCTGAACAACAAAGAAAAACATTATCTCACGATGCATGGCTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCTGTTTTCGTTGAGCACCAAACTGCTAAGTCTCGA
ATGGAAGAGCGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGAAC
TCTAAGTGATGCTTGCCGTGAACTTACTGAGCAACTCGCTGAACAACAAAGAAAAACATTATCTCACGATGCATGGCTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCTGTTTTCGTTGAGCACCAAACTGCTAAGTCTCGA
ATGGAAGAGCGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR22 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR21 |