Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 1015999..1016558 | Replicon | chromosome |
Accession | NZ_CP033144 | ||
Organism | Vibrio owensii strain V180403 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A347UR22 |
Locus tag | D0856_RS04825 | Protein ID | WP_005398411.1 |
Coordinates | 1015999..1016277 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A347UR21 |
Locus tag | D0856_RS04830 | Protein ID | WP_005398409.1 |
Coordinates | 1016274..1016558 (-) | Length | 95 a.a. |
Genomic Context
Location: 1011238..1011627 (390 bp)
Type: Others
Protein ID: WP_122067354.1
Type: Others
Protein ID: WP_122067354.1
Location: 1011645..1011734 (90 bp)
Type: Others
Protein ID: WP_071881309.1
Type: Others
Protein ID: WP_071881309.1
Location: 1011760..1012317 (558 bp)
Type: Others
Protein ID: WP_122067355.1
Type: Others
Protein ID: WP_122067355.1
Location: 1012340..1012432 (93 bp)
Type: Others
Protein ID: WP_005536857.1
Type: Others
Protein ID: WP_005536857.1
Location: 1012959..1013050 (92 bp)
Type: Others
Protein ID: Protein_911
Type: Others
Protein ID: Protein_911
Location: 1013538..1013669 (132 bp)
Type: Others
Protein ID: WP_122067358.1
Type: Others
Protein ID: WP_122067358.1
Location: 1013703..1014422 (720 bp)
Type: Others
Protein ID: WP_122067359.1
Type: Others
Protein ID: WP_122067359.1
Location: 1014437..1014529 (93 bp)
Type: Others
Protein ID: WP_072884142.1
Type: Others
Protein ID: WP_072884142.1
Location: 1014562..1015011 (450 bp)
Type: Others
Protein ID: WP_122067360.1
Type: Others
Protein ID: WP_122067360.1
Location: 1015053..1015142 (90 bp)
Type: Others
Protein ID: WP_206387583.1
Type: Others
Protein ID: WP_206387583.1
Location: 1015185..1015853 (669 bp)
Type: Others
Protein ID: WP_122067362.1
Type: Others
Protein ID: WP_122067362.1
Location: 1015881..1015970 (90 bp)
Type: Others
Protein ID: WP_122068866.1
Type: Others
Protein ID: WP_122068866.1
Location: 1016635..1016736 (102 bp)
Type: Others
Protein ID: Protein_921
Type: Others
Protein ID: Protein_921
Location: 1016773..1017591 (819 bp)
Type: Others
Protein ID: WP_122068868.1
Type: Others
Protein ID: WP_122068868.1
Location: 1017611..1017703 (93 bp)
Type: Others
Protein ID: WP_122067363.1
Type: Others
Protein ID: WP_122067363.1
Location: 1018158..1018250 (93 bp)
Type: Others
Protein ID: WP_017821981.1
Type: Others
Protein ID: WP_017821981.1
Location: 1018298..1018885 (588 bp)
Type: Others
Protein ID: WP_038880370.1
Type: Others
Protein ID: WP_038880370.1
Location: 1018900..1018992 (93 bp)
Type: Others
Protein ID: WP_079855765.1
Type: Others
Protein ID: WP_079855765.1
Location: 1019037..1019453 (417 bp)
Type: Others
Protein ID: WP_163000628.1
Type: Others
Protein ID: WP_163000628.1
Location: 1019479..1019571 (93 bp)
Type: Others
Protein ID: WP_206169873.1
Type: Others
Protein ID: WP_206169873.1
Location: 1019598..1020008 (411 bp)
Type: Others
Protein ID: WP_031847708.1
Type: Others
Protein ID: WP_031847708.1
Location: 1019998..1020132 (135 bp)
Type: Others
Protein ID: WP_122067366.1
Type: Others
Protein ID: WP_122067366.1
Location: 1020219..1020779 (561 bp)
Type: Others
Protein ID: WP_058666954.1
Type: Others
Protein ID: WP_058666954.1
Location: 1020795..1020926 (132 bp)
Type: Others
Protein ID: WP_206387584.1
Type: Others
Protein ID: WP_206387584.1
Location: 1020923..1021432 (510 bp)
Type: Others
Protein ID: WP_122067368.1
Type: Others
Protein ID: WP_122067368.1
Location: 1021455..1021547 (93 bp)
Type: Others
Protein ID: WP_086375043.1
Type: Others
Protein ID: WP_086375043.1
Location: 1015999..1016277 (279 bp)
Type: Toxin
Protein ID: WP_005398411.1
Type: Toxin
Protein ID: WP_005398411.1
Location: 1016274..1016558 (285 bp)
Type: Antitoxin
Protein ID: WP_005398409.1
Type: Antitoxin
Protein ID: WP_005398409.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D0856_RS04750 | 1011238..1011627 | + | 390 | WP_122067354.1 | DUF4345 domain-containing protein | - |
D0856_RS30730 | 1011645..1011734 | + | 90 | WP_071881309.1 | DUF3265 domain-containing protein | - |
D0856_RS04760 | 1011760..1012317 | + | 558 | WP_122067355.1 | nucleotidyltransferase family protein | - |
D0856_RS30735 | 1012340..1012432 | + | 93 | WP_005536857.1 | DUF3265 domain-containing protein | - |
D0856_RS04775 | 1012959..1013050 | + | 92 | Protein_911 | DUF3265 domain-containing protein | - |
D0856_RS04790 | 1013538..1013669 | + | 132 | WP_122067358.1 | DUF3265 domain-containing protein | - |
D0856_RS04795 | 1013703..1014422 | + | 720 | WP_122067359.1 | hypothetical protein | - |
D0856_RS04800 | 1014437..1014529 | + | 93 | WP_072884142.1 | DUF3265 domain-containing protein | - |
D0856_RS04805 | 1014562..1015011 | + | 450 | WP_122067360.1 | metal ABC transporter ATPase | - |
D0856_RS04810 | 1015053..1015142 | + | 90 | WP_206387583.1 | DUF3265 domain-containing protein | - |
D0856_RS04815 | 1015185..1015853 | + | 669 | WP_122067362.1 | hypothetical protein | - |
D0856_RS04820 | 1015881..1015970 | + | 90 | WP_122068866.1 | DUF3265 domain-containing protein | - |
D0856_RS04825 | 1015999..1016277 | - | 279 | WP_005398411.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
D0856_RS04830 | 1016274..1016558 | - | 285 | WP_005398409.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
D0856_RS04835 | 1016635..1016736 | + | 102 | Protein_921 | DUF3265 domain-containing protein | - |
D0856_RS04840 | 1016773..1017591 | + | 819 | WP_122068868.1 | DUF2971 domain-containing protein | - |
D0856_RS04845 | 1017611..1017703 | + | 93 | WP_122067363.1 | DUF3265 domain-containing protein | - |
D0856_RS04850 | 1018158..1018250 | + | 93 | WP_017821981.1 | DUF3265 domain-containing protein | - |
D0856_RS04855 | 1018298..1018885 | + | 588 | WP_038880370.1 | sugar O-acetyltransferase | - |
D0856_RS04860 | 1018900..1018992 | + | 93 | WP_079855765.1 | DUF3265 domain-containing protein | - |
D0856_RS04865 | 1019037..1019453 | + | 417 | WP_163000628.1 | GNAT family N-acetyltransferase | - |
D0856_RS04870 | 1019479..1019571 | + | 93 | WP_206169873.1 | DUF3265 domain-containing protein | - |
D0856_RS04875 | 1019598..1020008 | + | 411 | WP_031847708.1 | hydrolase | - |
D0856_RS04880 | 1019998..1020132 | + | 135 | WP_122067366.1 | DUF3265 domain-containing protein | - |
D0856_RS04885 | 1020219..1020779 | + | 561 | WP_058666954.1 | hypothetical protein | - |
D0856_RS04890 | 1020795..1020926 | + | 132 | WP_206387584.1 | DUF3265 domain-containing protein | - |
D0856_RS04895 | 1020923..1021432 | + | 510 | WP_122067368.1 | DUF4303 domain-containing protein | - |
D0856_RS30740 | 1021455..1021547 | + | 93 | WP_086375043.1 | DUF3265 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1003789..1099087 | 95298 | |
- | inside | Integron | - | - | 1002589..1090257 | 87668 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10891.57 Da Isoelectric Point: 4.3430
>T113248 WP_005398411.1 NZ_CP033144:c1016277-1015999 [Vibrio owensii]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
MILWEEESLNDREKIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
Download Length: 279 bp
>T113248 NZ_CP033144:c1016277-1015999 [Vibrio owensii]
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTCGAGTTTCTCTATGACTTCAATCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAAAGTAGAAAACTTGCTTGAACAACCTTTAATGGGTGTACAACGAGATGGCA
TCCGCGGACGATTGCTCATTATTCCTGAGATTTCGATGATTGTCTCTTATTGGGTCGAGGGCGATATCATCAGAGTTATG
CGTGTACTCCACCAGAAACAAAAATTCCCTACGGATTGA
ATGATTTTATGGGAAGAAGAGTCACTTAATGATCGTGAAAAGATCTTCGAGTTTCTCTATGACTTCAATCCTGATGCGGC
AGAAAAAACTGACAACCTCATTGAAGCAAAAGTAGAAAACTTGCTTGAACAACCTTTAATGGGTGTACAACGAGATGGCA
TCCGCGGACGATTGCTCATTATTCCTGAGATTTCGATGATTGTCTCTTATTGGGTCGAGGGCGATATCATCAGAGTTATG
CGTGTACTCCACCAGAAACAAAAATTCCCTACGGATTGA
Antitoxin
Download Length: 95 a.a. Molecular weight: 11069.40 Da Isoelectric Point: 9.2167
>AT113248 WP_005398409.1 NZ_CP033144:c1016558-1016274 [Vibrio owensii]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQTAKSR
MEERKARIRNRGKQ
Download Length: 285 bp
>AT113248 NZ_CP033144:c1016558-1016274 [Vibrio owensii]
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGCAC
TCTGAGTGACGCATGTCGTGAACTTACAGAGCAACTCGCTGAACAACAAAGAAAAACATTATCTCACGATGCATGGCTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCTGTTTTCGTTGAGCACCAAACTGCTAAGTCTCGA
ATGGAAGAGCGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA
ATGGACACTAGAATTCAATTTCGTGTTGATGAAGAAACAAAACGCCTAGCTCAACAAATGGCTGAGAGCCAAGGTCGCAC
TCTGAGTGACGCATGTCGTGAACTTACAGAGCAACTCGCTGAACAACAAAGAAAAACATTATCTCACGATGCATGGCTAA
CTGAACAAGTAAACCTAGCATTTGAGAAGTTTGACTCAGGAAAATCTGTTTTCGTTGAGCACCAAACTGCTAAGTCTCGA
ATGGAAGAGCGCAAAGCCAGAATCCGTAATCGAGGTAAGCAATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR22 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR21 |