TAfinder detailed results
Overview
| Job ID | 9mizKMmBqU | ||
| Sequence name | Escherichia coli strain DH5alpha chromosome, complete genome. | ||
| Predicted type | II | ||
Orphan Antitoxin (Protein)
| Predicted family | - (AT183) | Predicted domain | - |
| Locus tag | C1467_RS00815 | Length | 33 a.a. |
| Coordinates | 154103..154204 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1467_RS00765 | 150263..150406 | - | 144 | WP_001066080.1 | hypothetical protein | - |
| C1467_RS00770 | 150589..150912 | + | 324 | WP_000478193.1 | DUF3302 domain-containing protein | - |
| C1467_RS00775 | 150918..152054 | + | 1137 | WP_000364883.1 | HlyD family secretion protein | - |
| C1467_RS00780 | 152051..153025 | - | 975 | WP_000164033.1 | LysR family transcriptional regulator | - |
| C1467_RS00785 | 153149..153889 | + | 741 | WP_000906804.1 | MipA/OmpV family protein | - |
| C1467_RS25390 | 153836..154099 | - | 264 | Protein_142 | hypothetical protein | - |
| C1467_RS25135 | 154103..154204 | + | 102 | Protein_143 | AraC family transcriptional regulator | Antitoxin |
| C1467_RS00795 | 154236..154931 | - | 696 | WP_000893124.1 | L-ribulose-5-phosphate 4-epimerase | - |
| C1467_RS00800 | 154925..155785 | - | 861 | WP_001347869.1 | L-ribulose-5-phosphate 3-epimerase | - |
| C1467_RS00805 | 155778..156440 | - | 663 | WP_000089494.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| C1467_RS00810 | 156437..157933 | - | 1497 | WP_000196081.1 | L-xylulokinase | - |
| C1467_RS00815 | 157937..158923 | - | 987 | WP_000776892.1 | 2,3-diketo-L-gulonate TRAP transporter substrate-binding protein YiaO | - |
Domains
The domains were predicted by HMMER and were sorted by score.
Orphan Antitoxin
No domain identified.
Sequences
Orphan Antitoxin
Download Length: Molecular weight: 4024.56 Da Isoelectric Point: 11.1135
>Protein_143 Orphan_TA_2 Antitoxin
FNDVGYFRQIFRKHTGLTPAAWKRRYSKEHINS*
FNDVGYFRQIFRKHTGLTPAAWKRRYSKEHINS*
Download Length: 102 bp
>Protein_143 Orphan_TA_2 Antitoxin
TTTAATGACGTTGGCTATTTCCGGCAGATTTTTCGCAAGCACACCGGTTTAACGCCAGCA
GCGTGGAAGCGGCGTTACAGCAAGGAACATATCAATTCGTAG
TTTAATGACGTTGGCTATTTCCGGCAGATTTTTCGCAAGCACACCGGTTTAACGCCAGCA
GCGTGGAAGCGGCGTTACAGCAAGGAACATATCAATTCGTAG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| AT183 | Pseudomonas aeruginosa PAO1 |
40 |
8.803 |
0.294 |