TAfinder detailed results

Overview


Job ID 9mizKMmBqU
Sequence name Escherichia coli strain DH5alpha chromosome, complete genome.
Predicted type II

Orphan Antitoxin (Protein)


Predicted family - (AT183) Predicted domain -
Locus tag C1467_RS00815 Length 33 a.a.
Coordinates 154103..154204 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C1467_RS00765 150263..150406 - 144 WP_001066080.1 hypothetical protein -
C1467_RS00770 150589..150912 + 324 WP_000478193.1 DUF3302 domain-containing protein -
C1467_RS00775 150918..152054 + 1137 WP_000364883.1 HlyD family secretion protein -
C1467_RS00780 152051..153025 - 975 WP_000164033.1 LysR family transcriptional regulator -
C1467_RS00785 153149..153889 + 741 WP_000906804.1 MipA/OmpV family protein -
C1467_RS25390 153836..154099 - 264 Protein_142 hypothetical protein -
C1467_RS25135 154103..154204 + 102 Protein_143 AraC family transcriptional regulator Antitoxin
C1467_RS00795 154236..154931 - 696 WP_000893124.1 L-ribulose-5-phosphate 4-epimerase -
C1467_RS00800 154925..155785 - 861 WP_001347869.1 L-ribulose-5-phosphate 3-epimerase -
C1467_RS00805 155778..156440 - 663 WP_000089494.1 3-keto-L-gulonate-6-phosphate decarboxylase UlaD -
C1467_RS00810 156437..157933 - 1497 WP_000196081.1 L-xylulokinase -
C1467_RS00815 157937..158923 - 987 WP_000776892.1 2,3-diketo-L-gulonate TRAP transporter substrate-binding protein YiaO -

Domains


The domains were predicted by HMMER and were sorted by score.

Orphan Antitoxin


No domain identified.



Sequences


Orphan Antitoxin        


Download         Length:         Molecular weight: 4024.56 Da        Isoelectric Point: 11.1135

>Protein_143 Orphan_TA_2 Antitoxin
FNDVGYFRQIFRKHTGLTPAAWKRRYSKEHINS*

Download         Length: 102 bp

>Protein_143 Orphan_TA_2 Antitoxin
TTTAATGACGTTGGCTATTTCCGGCAGATTTTTCGCAAGCACACCGGTTTAACGCCAGCA
GCGTGGAAGCGGCGTTACAGCAAGGAACATATCAATTCGTAG

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
AT183 Pseudomonas aeruginosa PAO1

40

8.803

0.294