SecReT4
Protein ID: 295698182
T4SS name [ID]Tra_F [807]
Gene symbol-
Locus tagECL_B068
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconplasmid pECL_B [GenBank: NC_014108] [Browse all T4SS(s) in this replicon]
Location [Strand]34229..36772 [+]
Producttype IV secretory pathway VirB4 component
Component typeTraC_F
UniProt IDD5CL47
KEGG IDenc:ECL_B068
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7e-38, Aligned region: 450..747
TraC_F_IV [PF11130], Evalue: 2.3e-27, Aligned region: 34..243
Protein Sequence: 847 a.a.     [Download]
>gi|295698182|ref|YP_003602838.1| type IV secretory pathway VirB4 component [Enterobacter cloacae subsp. cloacae ATCC 13047]
MLNTLKTVAERHLFLRNEVTKSDILNMAVRDQPSEYLPYLAFKKRLPGEDVDTNAFINFDNTLGWIWELK
PLAFMGNDKLDKLHGIVRSQFPKGTVCQWILYPDHNLNSHIEEYCNIRDKSDPVTAMNMAQMEKFLREGA
DGVAKLFNIPLRNFRLFFTIKHEQRISEELLVAIHESFGIAGMEPRRWEASDLIKWAGEFFSGEPNNGLY
DPERQLRKQMNATNIDLSDPGSLIYAGHRYGVCLYPNVVPQGKNNPLNTNELFGGYMGVEDDMRQIKSPF
LYTLTIVYDDLRKNITDKATQTMFQRVGAGLAHSLRQRMEEYHIMQSMMAKDSKFHYMIPQLWVFGKTEK
EAFEAAAQAKNLWEGFDFQMMYEQSIKNVMFYTALPFGFYNIESNIDNIDRHFYLDNENIARFLPVQTDF
RGGGRPVQSLIGRKGQLISLDMYDKRANAHNFVVIAETGGGKSFFLNSMIDDYASIGAKTRIMDLGKSYE
KLTRIRKGRYIDFNLENPICINPLDFVANDDEDLAQNISAAQIVFSSAAYAFTGQYVNELEANLIDQACR
HAYSSGDGIRGTDAVTDFLTSGKFLESEYSDKHKKSIEEIQGVAFQLAYLLKAFKSDRAFGKFFCGPTTF
NIKDDDFVCTDLEKLRSVKQLFFPMVMNLMNAITMDLYLSDRSRPSIILVEEVASMLQKTGMVSMDGLTQ
MINEGYRRARKYRGAMGIVLQSPLDYEVLPGLGPVVKANAQWRYYLESRMYDEAVKKGLLPNITEGFPLK
LLSSVRNARPRYGEVFIDCPLGMGVARLCVDQWRYWVNTSDGADVAAFDRLMAEGKEPVDALKILSGVNP
DVLRAGR
 
Nucleotide Sequence: 2544 bp     [Download]
>gi|295698114|ref|NC_014108.1|:34229-36772 Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence
ATGCTTAACACTCTGAAAACGGTTGCTGAGCGCCACCTGTTCCTGCGCAATGAAGTCACTAAATCCGATA
TTCTGAATATGGCAGTTCGCGATCAGCCTAGCGAATATTTACCTTATCTCGCATTCAAGAAACGCCTGCC
AGGAGAGGATGTTGATACAAACGCCTTCATAAATTTTGACAATACGCTTGGCTGGATTTGGGAACTCAAA
CCACTGGCATTTATGGGAAATGACAAGCTCGATAAGCTGCATGGTATCGTGCGCTCCCAATTCCCGAAAG
GAACTGTATGCCAGTGGATTTTATATCCCGACCATAATCTGAACAGTCATATTGAAGAATACTGCAATAT
ACGCGATAAGAGCGATCCCGTTACAGCTATGAACATGGCACAGATGGAAAAATTTCTGCGTGAAGGTGCT
GACGGGGTCGCTAAATTGTTCAACATCCCGCTACGTAACTTCCGTCTGTTCTTCACCATCAAGCACGAGC
AGCGCATCTCTGAAGAACTTCTTGTAGCAATCCATGAATCTTTCGGCATTGCGGGGATGGAACCCCGCCG
CTGGGAGGCCTCTGATCTGATTAAATGGGCCGGTGAATTCTTTAGTGGTGAGCCTAATAACGGATTGTAT
GACCCGGAACGGCAGCTGCGTAAACAGATGAACGCAACAAACATCGACCTTAGCGATCCTGGCTCTTTAA
TTTATGCCGGACACCGCTACGGTGTATGTCTATATCCCAATGTTGTCCCACAGGGCAAAAATAACCCACT
CAATACGAATGAACTGTTTGGCGGTTACATGGGTGTTGAGGACGACATGCGACAAATCAAGTCGCCTTTC
CTTTATACCCTGACAATCGTTTACGACGACCTGCGCAAAAACATAACCGATAAGGCAACACAAACGATGT
TCCAGCGCGTTGGTGCTGGCTTGGCGCATTCGTTACGCCAACGAATGGAGGAATATCACATCATGCAAAG
CATGATGGCCAAAGACAGCAAATTCCATTACATGATCCCGCAGCTCTGGGTGTTTGGTAAAACGGAAAAG
GAAGCTTTTGAGGCCGCTGCGCAGGCTAAGAACTTATGGGAGGGCTTTGACTTCCAGATGATGTACGAGC
AGTCGATTAAGAACGTCATGTTCTATACAGCCCTGCCCTTCGGCTTTTATAACATCGAAAGCAATATCGA
TAATATAGACCGTCATTTTTATCTCGATAATGAAAATATCGCACGCTTCCTACCGGTTCAGACAGATTTT
CGTGGCGGTGGCCGTCCGGTGCAATCCCTCATTGGCCGCAAGGGTCAGCTAATCTCACTCGACATGTATG
ATAAGCGAGCGAACGCTCACAACTTCGTTGTGATCGCAGAAACGGGCGGGGGTAAATCGTTCTTCCTGAA
CAGCATGATCGATGATTACGCCAGTATTGGTGCCAAAACGCGAATCATGGATTTGGGTAAAAGCTATGAA
AAACTGACACGCATACGCAAAGGTCGCTACATAGATTTCAACCTCGAAAATCCCATATGCATCAACCCCC
TCGATTTTGTAGCCAATGATGATGAAGACCTGGCCCAGAATATTTCAGCGGCACAGATAGTCTTTAGTTC
TGCCGCATACGCGTTCACCGGCCAATATGTGAATGAACTGGAAGCCAACCTGATAGATCAGGCCTGTCGC
CACGCTTACAGTTCAGGTGATGGTATCAGGGGAACGGATGCCGTCACTGATTTTCTGACATCCGGCAAAT
TTCTGGAGTCGGAATACAGCGATAAGCACAAAAAAAGTATTGAAGAGATTCAAGGTGTCGCATTCCAGCT
CGCCTATCTACTGAAAGCTTTTAAATCTGATCGCGCCTTTGGCAAGTTCTTCTGCGGTCCAACGACCTTC
AACATCAAAGATGATGATTTCGTCTGTACTGACCTGGAGAAGCTGCGCTCTGTTAAGCAGCTATTCTTCC
CAATGGTCATGAACCTCATGAACGCGATTACGATGGATTTGTACCTCTCCGACCGCTCGCGTCCGAGCAT
TATCCTGGTCGAGGAAGTCGCCTCGATGTTGCAGAAAACCGGCATGGTTTCGATGGACGGTCTGACCCAG
ATGATAAACGAAGGCTATCGTCGCGCTCGTAAATACCGCGGCGCGATGGGGATCGTCCTTCAGTCACCGC
TGGATTATGAAGTGCTTCCAGGTCTAGGCCCGGTTGTTAAGGCAAACGCCCAATGGCGTTACTACCTGGA
ATCGCGCATGTACGACGAAGCGGTTAAGAAAGGCCTTCTTCCTAACATCACGGAAGGCTTCCCGCTTAAG
CTATTGAGCAGTGTTCGTAATGCCCGACCACGATACGGTGAAGTCTTTATCGACTGTCCGTTGGGTATGG
GAGTGGCTCGTCTTTGTGTGGATCAGTGGCGTTATTGGGTTAACACGTCAGACGGTGCAGATGTTGCTGC
ATTCGATCGGCTTATGGCTGAGGGCAAGGAACCTGTTGATGCTCTTAAAATACTCTCCGGGGTGAACCCG
GATGTACTGAGGGCCGGTCGATGA