SecReT4
Protein ID: 219586108
T4SS name [ID]Tra_F [110]
Gene symboltraC
Locus tagpO26I_p061
StrainEscherichia coli plasmid pO26-L (NC_011812)
Repliconplasmid pO26-L [GenBank: NC_011812] [Browse all T4SS(s) in this replicon]
Location [Strand]36100..38730 [+]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDQ6SJ14
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.2e-58, Aligned region: 38..278
AAA_10 [PF12846], Evalue: 4.1e-43, Aligned region: 480..773
DUF87 [PF01935], Evalue: 3.2e-05, Aligned region: 483..670
TrwB_AAD_bind [PF10412], Evalue: 7.4e-05, Aligned region: 480..518
Protein Sequence: 876 a.a.     [Download]
>gi|219586108|ref|YP_002456202.1| conjugal transfer ATP-binding protein TraC [Escherichia coli]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|219586047|ref|NC_011812.1|:36100-38730 Escherichia coli plasmid pO26-L, complete sequence
ATGAGTAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTG
ACGAATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTA
CCGTGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATT
CCCATCAATGGGGCGAATAAGTCCATTGTGGAGGCACTCGATCACATGCTGCGCACCAAACTGCCGCGCG
GTATTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAGTACGGGCTGCGTGA
GTTCTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCA
GCGACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTATTTATCT
CGTACTGTTCTCCCTCGAAGAAAAAAAGCCGGGCTGACATTCTGGAAATGGAAAACCTGGTGAAAATCAT
CCGGGCGTCGTTACAGGGGGCCAGTATCGCCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTC
GGGGAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTGATC
TGAATTATCAGTGTGTGGAGGACAGTTTTGACCTGAATGTCCGGGCTGATTACCTGACGCTGGGCCTGCG
TGAGAACGGCAGGAACAGCACGGCCCGTATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCCTTC
CTGTGGAATATGGCCGACAACTACAGCAACCTGCTGAACCCGGAACTGTCCATCTCCTGTCCGTTCATCC
TGACGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCT
GGAGAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGG
GAACTGCGTCAGCGTCTGGGCTCCGGTCAGTCTTCTGTCGTGTCCTACTTCCTCAACATCACAGCATTCT
GCAAGGACAACAATGAAACGGCGCTGGAAGTGGAGCAGGACATCCTGAACAGCTTCCGTAAAAACGGTTT
TGAGCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGTCTGCCCTTTATGGCCGGGAAA
GGGTTGTTTAAACAGCTGAAAGAGGCCGGAGTGGTTCAGCGCGCAGAGAGCTTTAATGTTGCCAACCTGA
TGCCGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGC
GTTTATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCGGTCTGTGGCACCTCCGGG
GCCGGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGGGGCTTTGCCGTGGTGT
TCGACATGGGGGATGGCTACAAGTCCCTGTGTGAGAACATGGGTGGCGTATATCTGGACGGTGAAACCCT
GCGTTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGTGACCAGTTGTCA
GTGATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGCTGCAGGCGGTCAGGGCCT
CCTGGCTGGCCAAAGAGAACAGGGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGACAG
CGAGCAGTATGCCGGGTCACCGACCATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTAC
ACTGCCAACGGCACTTACGGCCAGTATTTTAACTCCGATGAGCCGTCCCTGCGGGATGATGCGAAAATGG
TGGTGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCACTGCTGGTTGCGGTGATGTTCTCCCTGATTAT
CTACATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTTATTGATGAAGGCTGG
CGTCTGCTGGACTTCAAAAATCGCAAGGTCGGTGAGTTTATTGAGAAAGGTTACCGTACCGCCCGCCGTC
ATACCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGACAAGGCCTCCAGTGCGGC
CCGTGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCAAAATAC
AACCAGCTGTATCCGGACCAGTTCCAGCCACTGCAGCGCGACATGATTGGTAAGTTTGGTGCGGCCAAAG
ACCAGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGCCTGTTTGTGGACCC
GTTAAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAACGTAAAGAGGGG
CTGAGTATTCATGAGGCGGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAGATGGCTTCGCTGGAAG
CCTGGCTGGAAGAACATGAGAAATACAGGAGTGTTGCATGA