SecReT4
Protein ID: 219586097
T4SS name [ID]Tra_F [110]
Gene symboltraK
Locus tagpO26I_p050
StrainEscherichia coli plasmid pO26-L (NC_011812)
Repliconplasmid pO26-L [GenBank: NC_011812] [Browse all T4SS(s) in this replicon]
Location [Strand]30519..31247 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDQ46999, Q6SJ23
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 5.7e-69, Aligned region: 13..235
Protein Sequence: 242 a.a.     [Download]
>gi|219586097|ref|YP_002456191.1| conjugal transfer protein TraK [Escherichia coli]
MRKNNTAIIFGGLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADSVWTGNHLKMVRFVVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|219586047|ref|NC_011812.1|:30519-31247 Escherichia coli plasmid pO26-L, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCGGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACTGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTGGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAGCGTGGTCTGAACCTTTCCATTCAGGCTGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGAGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCTGTCCGTGGCGGAAAATTACCTGCAGGCTGGTATCAGGTTCCTGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATTCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGTCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGATTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA