SecReT4
Protein ID: 17233464
T4SS name [ID]Tra_F [105]
Gene symboltraH
Locus tagPSLT100
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconplasmid pSLT [GenBank: NC_003277] [Browse all T4SS(s) in this replicon]
Location [Strand]78468..79850 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDQ93GM2
KEGG IDstm:PSLT100
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2e-119, Aligned region: 32..381
Protein Sequence: 460 a.a.     [Download]
>gi|17233464|ref|NP_490584.1| conjugal transfer pilus assembly protein TraH [Salmonella typhimurium LT2]
MQGKTRIKPLFILCTALMTVAPAVSADVNSDMNQFFNKLGFASNTTQPSVWQGQAAGYASGGSLYARTQV
KNVQLVSMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQ
KMASDINSMNLSSCQAAQGIVGGLFPKTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSDSVRDKAS
DKDKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEIMPLPARTTDRAIIRALMEGGT
AKIYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLTSIQNKAVSDTPLDNKEKGFISSTTIPVFKYLV
DPQMLGVSTSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHITDNMNDATRQIASFQAQV
QVQQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGGAQ
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|17233403|ref|NC_003277.1|:78468-79850 Salmonella typhimurium LT2 plasmid pSLT, complete sequence
ATGCAGGGTAAAACGAGAATTAAACCGCTTTTCATATTATGTACGGCGCTGATGACCGTCGCACCCGCCG
TCTCTGCCGATGTGAACAGCGACATGAACCAGTTCTTCAATAAGCTGGGCTTTGCTTCCAATACCACACA
GCCCTCCGTCTGGCAGGGACAGGCGGCAGGATATGCCTCCGGCGGCTCTTTATATGCCCGGACACAGGTA
AAAAATGTCCAGCTGGTCTCCATGACCCTGCCGGATATCAATGCCGGTTGCGGGGGCATCGATGCCTATC
TCGGCTCATTCAGTTTCATTAACGGCGAGCAGCTGCAGCGTTTTGTGAAGCAGATTATGAGTAACGCCGC
AGGGTACTTTTTTGACCTTGCGCTGCAGACGACGGTGCCGGAAATCAAAACGGCAAAGGATTTTCTGCAG
AAAATGGCCTCCGACATTAACAGTATGAACCTCAGCTCCTGCCAGGCGGCGCAGGGGATTGTCGGGGGGC
TTTTCCCAAAAACACAGGTCTCCCAGCAGAAGGTCTGCCAGGACATTGCCGGTGAGAGCAATATTTTTGC
CGACTGGGCGGCGTCCCGGCAGGGATGTACTGTGGGCGGGCAATCCGACAGCGTCAGGGATAAAGCCAGT
GACAAGGATAAGGAGCGGGTGACCAAAAATATCAACATCATGTGGAATGCTTTGTCCAAAAACAGGATGT
TTGACGGCAACAAGGAGCTGAAAGAGTTCGTGATGACGCTGACCGGTTCACTGGTTTTTGGACCCAACGG
CGAAATCATGCCCCTGCCTGCCAGAACCACCGACCGGGCTATTATCCGGGCATTAATGGAAGGCGGAACG
GCGAAGATATACCACTGCAATGATTCGGATAAATGCCTGAAGGTGGTGGCCGACACGCCGGTGACCATCA
GTCGCGACAATGCGCTCAAATCACAGATTACGAAGCTGCTGACCAGTATTCAGAACAAGGCGGTCAGCGA
CACTCCCCTGGATAATAAGGAAAAAGGGTTTATCTCCAGCACCACCATCCCGGTTTTCAAATACCTGGTT
GACCCGCAGATGCTCGGCGTGTCAACCAGCATGATTTATCAGCTGACGGATTATATCGGGTACGACATCC
TGCTGCAGTATATCCAGGAGCTGATCCAGCAGGCCCGGGCGATGGTGGCCACAGGGAATTATGACGAGGC
GGTTATCGAACATATCACCGACAACATGAATGACGCGACCCGGCAGATAGCGTCCTTCCAGGCGCAGGTC
CAGGTGCAGCAGGATGCGCTGCTGGTTGTCGACCGTCAGATGAGCTACATGCGCCAGCAGCTGTCAGCCC
GCATGCTCAGCCGTTACCAGAACAACTATCATTTTGGCGGAGGTGCGCAGTGA