SecReT4
Protein ID: 118577376
T4SS name [ID]Tra_F [802]
Gene symbol-
Locus tagPpro_3774
StrainPelobacter propionicus DSM 2379
Repliconplasmid pPRO1 [GenBank: NC_008607] [Browse all T4SS(s) in this replicon]
Location [Strand]147659..148261 [-]
Producthypothetical protein
Component typeTraW_F
UniProt IDA0R7Q5
KEGG IDppd:Ppro_3774
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 200 a.a.     [Download]
>gi|118577376|ref|YP_899616.1| hypothetical protein Ppro_3774 [Pelobacter propionicus DSM 2379]
MKHLLFAAIIIAHTCNAIGSEIVTGMTYQISERDALEELEERVQKADWKKHIQSIKPNKYRPSNLIELPR
ARGASKFLVDMSYTVESDILNNKGELLYPKGYTFNPLDFISFEKTLVVINGDDPKQVRWFKSSSLKNKIN
VSLFLTQGDAISTSKDLARPVYYATKPLVARFQLRSVPSVVKASGRCMEVEEIFINGGKD
 
Nucleotide Sequence: 603 bp     [Download]
>gi|118577231|ref|NC_008607.1|:c148261-147659 Pelobacter propionicus DSM 2379 plasmid pPRO1, complete sequence
GTGAAACATTTACTGTTTGCTGCGATAATAATCGCTCATACCTGTAATGCCATTGGTAGTGAAATAGTTA
CTGGCATGACATACCAAATATCAGAAAGAGACGCACTAGAAGAACTTGAAGAGCGTGTACAAAAAGCTGA
TTGGAAAAAACATATACAGTCAATAAAACCGAATAAATACCGTCCTAGCAATTTAATTGAGCTTCCTAGA
GCTAGAGGTGCAAGCAAATTTCTGGTTGATATGAGCTATACCGTCGAATCAGATATTTTAAATAATAAAG
GAGAACTTCTGTACCCGAAAGGATATACCTTCAATCCGCTAGACTTTATATCATTTGAGAAAACTCTCGT
AGTTATTAATGGCGATGATCCTAAACAGGTCAGATGGTTCAAGTCTTCTAGTTTAAAAAACAAGATCAAT
GTATCTTTATTCTTAACCCAAGGTGATGCGATATCTACTTCAAAAGATCTCGCTAGACCTGTTTATTACG
CAACAAAACCACTGGTGGCACGTTTTCAGCTTAGATCGGTCCCATCCGTGGTAAAAGCAAGTGGAAGATG
CATGGAGGTGGAAGAGATCTTTATTAATGGAGGGAAGGATTGA